Entry information : HaSTC03HanXRQChr01g0003061
Entry ID 14578
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC03HanXRQChr01g0003061
Name HaSTC03HanXRQChr01g0003061
Class Stellacyanin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC03
start..stop
S start..stop
HaSTC12 137 1e-40 3..135 9..136
ThasSTC02 136 2e-40 5..169 1..168
HaSTC02 134 9e-40 4..173 6..172
AtSTC02 127 4e-37 9..124 4..121
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13546687..13546861 175 N° 2 13547737..13548302 566  
join(13546687..13546861,13547737..13548302)


exon

Literature and cross-references HaSTC03HanXRQChr01g0003061
DNA ref. HanXRQ genome:   HanXRQChr01 (13546687..13548302)
Protein sequence: HaSTC03HanXRQChr01g0003061
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   246 (223)
PWM (Da):   %s   26299.15 (23832.9) Transmb domain:   %s   i225-244o
PI (pH):   %s   6.71 (6.29) Peptide Signal:   %s   cut: 24 range:24-246
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRTMIKMMMVVAVVTTVITAAMGGEVYTVGDKAGWTSVGHVDYKTWASSKLFQVGDTIVFRYNEIFHDVARVSYTDFITCNGSKPYTTFTSGNDSFPIKYPGHYFFICTQSNHCQIGQKVDIRVPVSGAHDAPQPIAAGVPAPLQPLPFPYPQPYVPVPAPAPAPVTPSLAPVAHSPAPVPHSHAPVPQSPVPVPSVDDESLAPTKAVPAPEIAPAQEKNMGGQLGFGFEIWSMMVVVFYLFGFGF

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAACAATGATCAAGATGATGATGGTGGTGGCGGTGGTTACGACGGTGATCACGGCGGCGATGGGCGGAGAGGTTTATACGGTTGGTGATAAGGCTGGTTGGACGAGCGTTGGTCAT
GTGGATTATAAAACTTGGGCTTCTTCAAAGTTATTTCAAGTTGGTGACACCATTG
GTATATTACTTCAATAGAATTATCAAGTAGTTTTTTTTTTTTTTTTTTTTTTCATAAAGTTAAAT
TTGGATTAAAAAGTATTATAAGTTTTAGAACTAAGGATGAGCATTTGGTACTTGGTATTGAACTGTATCGGTATCGATTTTTTTGGTACCGAATCGGTACCCTCTTTTTGGTGTTTTCGG
TACGGTAGAGGTATATTACTGAAATTTACCCTCAAATACCGGTATCCATATTTGATGAATTTTAATGCTGGTATTTTCGATACTGATACCGAGCTCATACCTATTAGAAACTTGAAAATG
GACTGCTAAGTTGGAAGGGAGGGTAGAATGTGCTTGGATGAAAGTTTTCAATTTAATTAAAAAAATAGAATTAGACTTTATAAAAAAAAAAAAAACTAACAGTTTACTATATTATATATA
GATGCAAAAATTAGATTAGAATAGTCAATTATGATTTTTTTTTAATTTAAGTTTTCACTAATGGATTAATGAAATAAAAAATCCTAAGGAAGGATTGAAGGGTTACCTTATATTTTTTTA
AGTTGGATTTAAATATTTGAAATGTTAGATGTGTTCTAGTTTTTGGTTAAACATATTTGTATAACTAATTGTTAGATAAAAACATAATCATATTTTTTCTAAATATACTTTTTTTTATGA
TAAGAAATTTATATTGCATTTATCTAAACAAGTCTTCTCAATTCATAATTTAAACCTTTTTTTTTTCTAAAACTGTTGAAATGCAAATTTACAAAGATTCTATTAGTTAGGTATTTTTTT
AAACCATATAATAAATGTTATATTAATTCATATCAATAATATTAAACAATTTTGTCATCTAATTTTCTTCCATTTTTTTTTTTTTTGTAGTTTTTCGTTACAATGAAATATTCCATGACG
TAGCAAGAGTTTCATACACCGATTTCATAACATGCAACGGTAGCAAGCCTTACACCACCTTCACCTCCGGCAACGACTCATTTCCGATCAAATATCCCGGCCACTACTTCTTCATCTGCA
CCCAATCCAACCACTGCCAAATCGGCCAAAAAGTCGACATTCGGGTACCCGTTTCAGGCGCGCACGACGCTCCTCAGCCCATCGCCGCAGGCGTCCCCGCCCCATTGCAACCGCTTCCGT
TCCCCTACCCGCAACCTTATGTTCCGGTACCAGCACCAGCACCGGCGCCAGTGACACCTTCTCTGGCGCCGGTGGCTCACTCCCCTGCGCCGGTGCCTCACTCCCATGCACCGGTGCCTC
AGTCTCCGGTGCCGGTGCCTTCTGTGGATGATGAGTCTTTGGCACCGACGAAGGCGGTTCCGGCACCGGAAATTGCACCGGCGCAAGAGAAGAATATGGGTGGTCAACTAGGGTTTGGGT
TTGAGATTTGGTCAATGATGGTGGTTGTTTTTTATTTGTTTGGGTTTGGTTTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAACAATGATCAAGATGATGATGGTGGTGGCGGTGGTTACGACGGTGATCACGGCGGCGATGGGCGGAGAGGTTTATACGGTTGGTGATAAGGCTGGTTGGACGAGCGTTGGTCAT
GTGGATTATAAAACTTGGGCTTCTTCAAAGTTATTTCAAGTTGGTGACACCATTG
TTTTTCGTTACAATGAAATATTCCATGACGTAGCAAGAGTTTCATACACCGATTTCATAACATGC
AACGGTAGCAAGCCTTACACCACCTTCACCTCCGGCAACGACTCATTTCCGATCAAATATCCCGGCCACTACTTCTTCATCTGCACCCAATCCAACCACTGCCAAATCGGCCAAAAAGTC
GACATTCGGGTACCCGTTTCAGGCGCGCACGACGCTCCTCAGCCCATCGCCGCAGGCGTCCCCGCCCCATTGCAACCGCTTCCGTTCCCCTACCCGCAACCTTATGTTCCGGTACCAGCA
CCAGCACCGGCGCCAGTGACACCTTCTCTGGCGCCGGTGGCTCACTCCCCTGCGCCGGTGCCTCACTCCCATGCACCGGTGCCTCAGTCTCCGGTGCCGGTGCCTTCTGTGGATGATGAG
TCTTTGGCACCGACGAAGGCGGTTCCGGCACCGGAAATTGCACCGGCGCAAGAGAAGAATATGGGTGGTCAACTAGGGTTTGGGTTTGAGATTTGGTCAATGATGGTGGTTGTTTTTTAT
TTGTTTGGGTTTGGTTTTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAACAA TGATCAAGAT GATGATGGTG GTGGCGGTGG TTACGACGGT GATCACGGCG GCGATGGGCG GAGAGGTTTA TACGGTTGGT GATAAGGCTG GTTGGACGAG CGTTGGTCAT  GTGGATTATA AAACTTGGGC TTCTTCAAAG TTATTTCAAG TTGGTGACAC CATTGTTTTT CGTTACAATG AAATATTCCA TGACGTAGCA AGAGTTTCAT ACACCGATTT CATAACATGC  AACGGTAGCA AGCCTTACAC CACCTTCACC TCCGGCAACG ACTCATTTCC GATCAAATAT CCCGGCCACT ACTTCTTCAT CTGCACCCAA TCCAACCACT GCCAAATCGG CCAAAAAGTC  GACATTCGGG TACCCGTTTC AGGCGCGCAC GACGCTCCTC AGCCCATCGC CGCAGGCGTC CCCGCCCCAT TGCAACCGCT TCCGTTCCCC TACCCGCAAC CTTATGTTCC GGTACCAGCA  CCAGCACCGG CGCCAGTGAC ACCTTCTCTG GCGCCGGTGG CTCACTCCCC TGCGCCGGTG CCTCACTCCC ATGCACCGGT GCCTCAGTCT CCGGTGCCGG TGCCTTCTGT GGATGATGAG  TCTTTGGCAC CGACGAAGGC GGTTCCGGCA CCGGAAATTG CACCGGCGCA AGAGAAGAAT ATGGGTGGTC AACTAGGGTT TGGGTTTGAG ATTTGGTCAA TGATGGTGGT TGTTTTTTAT 
TTGTTTGGGT TTGGTTTTTA G 

Retrieve as FASTA