Entry information : HaSTC06HanXRQChr03g0087401
Entry ID 14581
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC06HanXRQChr03g0087401
Name HaSTC06HanXRQChr03g0087401
Class Stellacyanin    [Orthogroup: STC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC06
start..stop
S start..stop
HaSTC09 228 3e-78 1..147 1..156
HaSTC07 221 1e-75 1..147 1..155
HaSTC08 216 2e-73 1..147 1..155
HaSTC10 202 2e-68 1..120 1..120
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150189177..150189342 166 N° 2 150188795..150189099 305  
complement(join(150188795..150189099,150189177..150189342))


exon

Literature and cross-references HaSTC06HanXRQChr03g0087401
DNA ref. HanXRQ genome:   HanXRQChr03 (150189342..150188795)
Protein sequence: HaSTC06HanXRQChr03g0087401
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   156 (133)
PWM (Da):   %s   16655.52 (14276.2) Transmb domain:   %s   i7-29o133-155i
PI (pH):   %s   9.14 (8.81) Peptide Signal:   %s   cut: 24 range:24-156
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAARSTIIFISTIFLLATSISAKEYVVGDGSGWTLDFDYQAWAKDKVFYVGDKLVFNYASGTHNVVKVNGTGFQQCSTSSNNGTLTSGRDVIPLQTPGKKWYICGVAKHCESRNMKLVITVLSQSMSSAVAISPVSITYGIVAALFSGLMLTFLV

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGGCACGTTCTACCATTATCTTCATCTCAACAATCTTTCTTCTTGCAACTTCGATTTCTGCCAAAGAATACGTTGTCGGTGATGGAAGCGGTTGGACTCTCGACTTCGATTAT
CAAGCGTGGGCCAAGGATAAAGTTTTCTACGTCGGAGATAAACTCG
GTACGTTATATTCCTACAAATATGGTTGACAATATTTGTTGTAAACTAAACAAATGTTTTAAATTTTGGTTACA
TAGTTTTTAATTACGCGTCTGGCACGCACAATGTGGTGAAAGTCAACGGCACGGGTTTCCAACAATGTAGCACGTCATCAAACAATGGAACTTTGACAAGTGGACGAGACGTCATCCCAC
TTCAAACCCCTGGAAAGAAATGGTACATTTGTGGTGTCGCGAAGCATTGTGAGTCGAGAAACATGAAGCTTGTCATCACCGTTCTATCACAGTCGATGTCTTCGGCTGTTGCCATATCAC
CGGTATCTATAACTTATGGTATTGTAGCTGCATTGTTTAGTGGTCTCATGTTAACATTCTTGGTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGGCACGTTCTACCATTATCTTCATCTCAACAATCTTTCTTCTTGCAACTTCGATTTCTGCCAAAGAATACGTTGTCGGTGATGGAAGCGGTTGGACTCTCGACTTCGATTAT
CAAGCGTGGGCCAAGGATAAAGTTTTCTACGTCGGAGATAAACTCG
TTTTTAATTACGCGTCTGGCACGCACAATGTGGTGAAAGTCAACGGCACGGGTTTCCAACAATGTAGCACGTCA
TCAAACAATGGAACTTTGACAAGTGGACGAGACGTCATCCCACTTCAAACCCCTGGAAAGAAATGGTACATTTGTGGTGTCGCGAAGCATTGTGAGTCGAGAAACATGAAGCTTGTCATC
ACCGTTCTATCACAGTCGATGTCTTCGGCTGTTGCCATATCACCGGTATCTATAACTTATGGTATTGTAGCTGCATTGTTTAGTGGTCTCATGTTAACATTCTTGGTTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGG CACGTTCTAC CATTATCTTC ATCTCAACAA TCTTTCTTCT TGCAACTTCG ATTTCTGCCA AAGAATACGT TGTCGGTGAT GGAAGCGGTT GGACTCTCGA CTTCGATTAT  CAAGCGTGGG CCAAGGATAA AGTTTTCTAC GTCGGAGATA AACTCGTTTT TAATTACGCG TCTGGCACGC ACAATGTGGT GAAAGTCAAC GGCACGGGTT TCCAACAATG TAGCACGTCA  TCAAACAATG GAACTTTGAC AAGTGGACGA GACGTCATCC CACTTCAAAC CCCTGGAAAG AAATGGTACA TTTGTGGTGT CGCGAAGCAT TGTGAGTCGA GAAACATGAA GCTTGTCATC 
ACCGTTCTAT CACAGTCGAT GTCTTCGGCT GTTGCCATAT CACCGGTATC TATAACTTAT GGTATTGTAG CTGCATTGTT TAGTGGTCTC ATGTTAACAT TCTTGGTTTA G 

Retrieve as FASTA