Entry information : HaSTC07HanXRQChr03g0087411
Entry ID 14582
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC07HanXRQChr03g0087411
Name HaSTC07HanXRQChr03g0087411
Class Stellacyanin    [Orthogroup: STC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC07
start..stop
S start..stop
HaSTC08 318 5e-114 1..157 1..157
HaSTC09 303 8e-108 1..157 1..158
HaSTC06 226 3e-77 1..160 1..152
HaSTC10 224 9e-77 1..120 1..120
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150194249..150194414 166 N° 2 150194699..150195024 326  
join(150194249..150194414,150194699..150195024)


exon

Literature and cross-references HaSTC07HanXRQChr03g0087411
DNA ref. HanXRQ genome:   HanXRQChr03 (150194249..150195024)
Protein sequence: HaSTC07HanXRQChr03g0087411
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   163 (140)
PWM (Da):   %s   17609.03 (15110.7) Transmb domain:   %s   i7-29o143-162i
PI (pH):   %s   8.81 (8.46) Peptide Signal:   %s   cut: 24 range:24-163
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSRLNIFFMATIFVLVTSIAAKEYVVGDENGWKLDFDYQNWAKDKVFYVGDTLVFNYAAGVHNVAKVNGTGFQQCSTSASNGIMTSGQDVVPLQTPGRKWYICGVGKHCELRNMKLVITVLPQTWAPAPSPMATSTSGKLAVPTIYGFVVALFGSLLLLLV

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACATCCCGTTTGAACATTTTCTTCATGGCTACAATTTTTGTTCTCGTGACTTCAATTGCTGCGAAGGAATACGTTGTGGGGGATGAAAATGGTTGGAAACTCGACTTTGATTAT
CAAAATTGGGCCAAGGATAAAGTTTTCTACGTCGGAGATACCCTTG
GTATGTTATATATATCCCCGTCATTTTATTTAGATTTCTACTACAAAACTGGGTATTTGCAACGATCAATTTGG
TCACAAACCGGTAACAAAAAGCTTCGCAAAATCTGTTTTGCGACCGGTTTTAGCAACTAAAAAACCACTTTGTTTGTACCTGTGACTTGGATGCGGTCGCTACTTTTGTAACACTTTTAA
ATTCTGTCGCAAACTTTGCGACCGAAAACGTACATCTCCCATTCGCAAGTCGTTTAATAAATGTAATCCTGTACAATTCTCTTGATGCAGTTTTCAACTATGCGGCTGGTGTTCACAATG
TTGCGAAAGTCAACGGCACCGGTTTCCAACAATGTAGCACTTCAGCTTCCAATGGAATCATGACAAGTGGACAGGATGTTGTTCCCCTACAAACCCCTGGAAGGAAATGGTACATTTGTG
GTGTCGGAAAGCATTGCGAATTGAGAAACATGAAGCTTGTCATCACTGTTCTACCTCAAACATGGGCTCCGGCTCCAAGCCCAATGGCGACATCTACATCTGGCAAATTGGCAGTACCAA
CTATCTATGGATTTGTAGTTGCATTATTCGGCAGCCTGCTATTGCTATTGGTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACATCCCGTTTGAACATTTTCTTCATGGCTACAATTTTTGTTCTCGTGACTTCAATTGCTGCGAAGGAATACGTTGTGGGGGATGAAAATGGTTGGAAACTCGACTTTGATTAT
CAAAATTGGGCCAAGGATAAAGTTTTCTACGTCGGAGATACCCTTG
TTTTCAACTATGCGGCTGGTGTTCACAATGTTGCGAAAGTCAACGGCACCGGTTTCCAACAATGTAGCACTTCA
GCTTCCAATGGAATCATGACAAGTGGACAGGATGTTGTTCCCCTACAAACCCCTGGAAGGAAATGGTACATTTGTGGTGTCGGAAAGCATTGCGAATTGAGAAACATGAAGCTTGTCATC
ACTGTTCTACCTCAAACATGGGCTCCGGCTCCAAGCCCAATGGCGACATCTACATCTGGCAAATTGGCAGTACCAACTATCTATGGATTTGTAGTTGCATTATTCGGCAGCCTGCTATTG
CTATTGGTTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACAT CCCGTTTGAA CATTTTCTTC ATGGCTACAA TTTTTGTTCT CGTGACTTCA ATTGCTGCGA AGGAATACGT TGTGGGGGAT GAAAATGGTT GGAAACTCGA CTTTGATTAT  CAAAATTGGG CCAAGGATAA AGTTTTCTAC GTCGGAGATA CCCTTGTTTT CAACTATGCG GCTGGTGTTC ACAATGTTGC GAAAGTCAAC GGCACCGGTT TCCAACAATG TAGCACTTCA  GCTTCCAATG GAATCATGAC AAGTGGACAG GATGTTGTTC CCCTACAAAC CCCTGGAAGG AAATGGTACA TTTGTGGTGT CGGAAAGCAT TGCGAATTGA GAAACATGAA GCTTGTCATC  ACTGTTCTAC CTCAAACATG GGCTCCGGCT CCAAGCCCAA TGGCGACATC TACATCTGGC AAATTGGCAG TACCAACTAT CTATGGATTT GTAGTTGCAT TATTCGGCAG CCTGCTATTG 
CTATTGGTTT GA 

Retrieve as FASTA