Entry information : HaSTC08HanXRQChr03g0087421
Entry ID 14583
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC08HanXRQChr03g0087421
Name HaSTC08HanXRQChr03g0087421
Class Stellacyanin    [Orthogroup: STC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC08
start..stop
S start..stop
HaSTC07 319 5e-114 1..157 1..157
HaSTC09 297 2e-105 1..157 1..158
HaSTC06 219 7e-75 1..160 1..152
HaSTC10 218 1e-74 1..120 1..120
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150202451..150202616 166 N° 2 150202881..150203206 326  
join(150202451..150202616,150202881..150203206)


exon

Literature and cross-references HaSTC08HanXRQChr03g0087421
DNA ref. HanXRQ genome:   HanXRQChr03 (150202451..150203206)
Protein sequence: HaSTC08HanXRQChr03g0087421
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   163 (140)
PWM (Da):   %s   17626.01 (15069.6) Transmb domain:   %s   i7-29o143-162i
PI (pH):   %s   8.46 (8.04) Peptide Signal:   %s   cut: 24 range:24-163
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSRLNIFFMVTIFVLVTSITATEYVVGDENGWKLDFDYQNWAKDKAFYVGDTLVFNYAAGVHNVAKVNGTGFQQCSTSASNGIMTSGQDVVPLQTPGRKWYICGVGKHCELRNMKLVITVLPQTWAPAPSPMATSTSGKLAVPTIYGFLVALFGSLLLLLV

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACATCCCGTTTGAACATTTTCTTCATGGTTACAATTTTTGTTCTCGTGACTTCAATCACTGCAACGGAATACGTTGTGGGGGATGAAAATGGTTGGAAACTCGACTTTGATTAT
CAAAATTGGGCCAAGGATAAAGCTTTCTACGTCGGAGATACCCTTG
GTATGTTACATATCCCCGTAATTTTATATATATTTCTACTACAAAACTGGGTATTGCAACGACCAATTTGGTCA
CAAATCCGTAACAAAAAAGCCAATCTGTTTTGCGACTAGTTTTAGCAACTAAGAAACCACTTAGTTTGTATCTGTGACTTGGATGCGGTCGCTACTTTGTGACACTTTTAAATTCTGTCG
CAAACTTTGCGACCATTTTCGTTACAAAGACGTTTAATAAATGTAATCCTTTACAATTCTCTTGATGCAGTTTTCAACTATGCGGCTGGTGTTCACAACGTTGCGAAAGTCAACGGCACC
GGTTTCCAACAATGTAGCACTTCAGCTTCCAATGGAATCATGACAAGTGGACAGGATGTTGTCCCCCTACAAACCCCCGGAAGGAAATGGTACATTTGTGGTGTCGGAAAGCATTGCGAG
TTGAGAAACATGAAGCTTGTCATCACTGTTCTACCTCAAACATGGGCTCCGGCTCCAAGCCCTATGGCGACATCTACATCGGGCAAATTGGCAGTACCAACTATCTATGGATTTCTAGTT
GCATTATTCGGCAGTCTGCTATTGCTGTTGGTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACATCCCGTTTGAACATTTTCTTCATGGTTACAATTTTTGTTCTCGTGACTTCAATCACTGCAACGGAATACGTTGTGGGGGATGAAAATGGTTGGAAACTCGACTTTGATTAT
CAAAATTGGGCCAAGGATAAAGCTTTCTACGTCGGAGATACCCTTG
TTTTCAACTATGCGGCTGGTGTTCACAACGTTGCGAAAGTCAACGGCACCGGTTTCCAACAATGTAGCACTTCA
GCTTCCAATGGAATCATGACAAGTGGACAGGATGTTGTCCCCCTACAAACCCCCGGAAGGAAATGGTACATTTGTGGTGTCGGAAAGCATTGCGAGTTGAGAAACATGAAGCTTGTCATC
ACTGTTCTACCTCAAACATGGGCTCCGGCTCCAAGCCCTATGGCGACATCTACATCGGGCAAATTGGCAGTACCAACTATCTATGGATTTCTAGTTGCATTATTCGGCAGTCTGCTATTG
CTGTTGGTTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACAT CCCGTTTGAA CATTTTCTTC ATGGTTACAA TTTTTGTTCT CGTGACTTCA ATCACTGCAA CGGAATACGT TGTGGGGGAT GAAAATGGTT GGAAACTCGA CTTTGATTAT  CAAAATTGGG CCAAGGATAA AGCTTTCTAC GTCGGAGATA CCCTTGTTTT CAACTATGCG GCTGGTGTTC ACAACGTTGC GAAAGTCAAC GGCACCGGTT TCCAACAATG TAGCACTTCA  GCTTCCAATG GAATCATGAC AAGTGGACAG GATGTTGTCC CCCTACAAAC CCCCGGAAGG AAATGGTACA TTTGTGGTGT CGGAAAGCAT TGCGAGTTGA GAAACATGAA GCTTGTCATC  ACTGTTCTAC CTCAAACATG GGCTCCGGCT CCAAGCCCTA TGGCGACATC TACATCGGGC AAATTGGCAG TACCAACTAT CTATGGATTT CTAGTTGCAT TATTCGGCAG TCTGCTATTG 
CTGTTGGTTT GA 

Retrieve as FASTA