Entry information : HaSTC09HanXRQChr03g0087431
Entry ID 14584
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC09HanXRQChr03g0087431
Name HaSTC09HanXRQChr03g0087431
Class Stellacyanin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC09
start..stop
S start..stop
HaSTC07 303 1e-107 1..158 1..157
HaSTC08 296 4e-105 1..158 1..157
HaSTC06 232 9e-80 1..161 1..152
HaSTC10 231 1e-79 1..120 1..120
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150205594..150205759 166 N° 2 150206095..150206423 329  
join(150205594..150205759,150206095..150206423)


exon

Literature and cross-references HaSTC09HanXRQChr03g0087431
DNA ref. HanXRQ genome:   HanXRQChr03 (150205594..150206423)
Protein sequence: HaSTC09HanXRQChr03g0087431
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 164 (141)
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
17517.05 (15123.7) Transmb domain: %sTransmembrane domain
Calculation done with TMHMM
The topology is given as the position of the transmembrane helices
separated by i if the loop is on the inside or o if it is on the outside.
For example i7-29o44-66i87-109o means that it starts on the inside,
has a predicted TMH at position 7 to 29, the outside, then a TMH at position 44-66 etc.
i7-29o144-163i
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
9.14 (8.81) Peptide Signal: %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 24 range:24-164
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSRLSIVFIATIFVLATSISAKDYIVGDENGWKLDFDYQNWAKDKVFYVGDTLVFNYAAGAHNVAKVNGTGFQQCSTSASNGIMTSGRDVVPLQTPGRKWYICGVGKHCESRNMKLVITVLPQTWAPAPSPIATSTSAGKLAVPTIYGFVVGLFGSLLLLLV

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACATCCCGTTTGAGCATCGTCTTCATTGCCACAATTTTTGTTCTCGCGACCTCAATCTCTGCGAAGGATTACATCGTCGGAGATGAAAATGGTTGGAAACTCGACTTTGATTAT
CAAAATTGGGCCAAGGATAAAGTTTTCTACGTCGGAGATACCCTTG
GTATGTTATATATCCCCGTCATTTTATTTAAATTCATTTACAAAACAACGACCAACTTGGTCGCAAATTGGTAA
CAAATATTTTTGCAACCAAAATTGACATTCGCAATCTGTCGCAAGTATATTTTGGGACCTGTTTTAGCGCAACTAAAAAAACAGTTTATATATTTGTGTGGGCCATAATTTGCAACCGAC
TTGTCACTTGGATACTGCCACTACTTTTGTGACCACCTAAATTTTGTGGCAAATTTTGGGACTATTTTGGGTTAAAAAAATTCAACATTATTGTTTCCAAGATGTTTAATAAATGTAATC
CTTTACAATTCTCTTATGCAGTTTTCAACTATGCGGCCGGTGCACACAACGTTGCGAAAGTCAACGGCACCGGTTTCCAACAATGTAGCACTTCAGCTTCCAATGGAATCATGACAAGTG
GACGGGATGTTGTCCCCCTACAAACCCCTGGAAGGAAATGGTACATTTGTGGTGTCGGAAAGCACTGCGAGTCGAGAAACATGAAGCTTGTCATCACCGTTCTACCTCAAACATGGGCTC
CTGCTCCAAGCCCAATAGCGACATCCACATCAGCTGGCAAGTTGGCGGTACCAACTATCTATGGATTTGTAGTTGGATTATTCGGCAGTCTTTTGTTGCTCTTGGTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACATCCCGTTTGAGCATCGTCTTCATTGCCACAATTTTTGTTCTCGCGACCTCAATCTCTGCGAAGGATTACATCGTCGGAGATGAAAATGGTTGGAAACTCGACTTTGATTAT
CAAAATTGGGCCAAGGATAAAGTTTTCTACGTCGGAGATACCCTTG
TTTTCAACTATGCGGCCGGTGCACACAACGTTGCGAAAGTCAACGGCACCGGTTTCCAACAATGTAGCACTTCA
GCTTCCAATGGAATCATGACAAGTGGACGGGATGTTGTCCCCCTACAAACCCCTGGAAGGAAATGGTACATTTGTGGTGTCGGAAAGCACTGCGAGTCGAGAAACATGAAGCTTGTCATC
ACCGTTCTACCTCAAACATGGGCTCCTGCTCCAAGCCCAATAGCGACATCCACATCAGCTGGCAAGTTGGCGGTACCAACTATCTATGGATTTGTAGTTGGATTATTCGGCAGTCTTTTG
TTGCTCTTGGTTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACAT CCCGTTTGAG CATCGTCTTC ATTGCCACAA TTTTTGTTCT CGCGACCTCA ATCTCTGCGA AGGATTACAT CGTCGGAGAT GAAAATGGTT GGAAACTCGA CTTTGATTAT  CAAAATTGGG CCAAGGATAA AGTTTTCTAC GTCGGAGATA CCCTTGTTTT CAACTATGCG GCCGGTGCAC ACAACGTTGC GAAAGTCAAC GGCACCGGTT TCCAACAATG TAGCACTTCA  GCTTCCAATG GAATCATGAC AAGTGGACGG GATGTTGTCC CCCTACAAAC CCCTGGAAGG AAATGGTACA TTTGTGGTGT CGGAAAGCAC TGCGAGTCGA GAAACATGAA GCTTGTCATC  ACCGTTCTAC CTCAAACATG GGCTCCTGCT CCAAGCCCAA TAGCGACATC CACATCAGCT GGCAAGTTGG CGGTACCAAC TATCTATGGA TTTGTAGTTG GATTATTCGG CAGTCTTTTG 
TTGCTCTTGG TTTAA 

Retrieve as FASTA