Entry information : HaSTC10HanXRQChr03g0087441
Entry ID 14585
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC10HanXRQChr03g0087441
Name HaSTC10HanXRQChr03g0087441
Class Stellacyanin    [Orthogroup: STC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC10
start..stop
S start..stop
HaSTC09 230 2e-79 1..120 1..120
HaSTC07 223 2e-76 1..120 1..120
HaSTC08 217 3e-74 1..120 1..120
HaSTC06 202 2e-68 1..120 1..120
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150208265..150208430 166 N° 2 150208614..150208858 245  
join(150208265..150208430,150208614..150208858)


exon

Literature and cross-references HaSTC10HanXRQChr03g0087441
DNA ref. HanXRQ genome:   HanXRQChr03 (150208265..150208858)
Protein sequence: HaSTC10HanXRQChr03g0087441
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   136 (113)
PWM (Da):   %s   15010.48 (12485.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.81 (8.47) Peptide Signal:   %s   cut: 24 range:24-136
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTSRMSISFVATFFVLATSIYAKEYIVGDENGWKLDFDYQTWAKDKVFFVGDTLVFNYAAGAHTVAKVNGTSFQQCSTSASNGIMTSGHDVIPLQTPGRKWYICGVGKHCESRNMKLVVRAGILLYMILTRDPNQ

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCACATCCCGTATGAGCATTAGCTTCGTAGCAACATTTTTTGTTCTTGCGACATCGATCTACGCTAAGGAATACATCGTCGGGGATGAAAATGGTTGGAAACTCGATTTTGATTAC
CAAACTTGGGCCAAGGACAAAGTATTCTTCGTTGGAGATACCCTTG
GTACGTTTTATTACCAAACTTGGACTTGGATACACTTGCCAATTTTGTTGTCATTTTAAATTCTGTCGCAAAAA
TTCAGCCGTTAATTCTGGGTTATGAACTATTGACCTAGTGTAATACCATTTCGCACATTTCTCGTTTCCAAGATGTTTAATATAATCCTTTATGATTCTCTTGATGCAGTATTCAACTAT
GCGGCTGGTGCCCACACTGTCGCAAAAGTCAATGGAACAAGTTTCCAACAATGTAGCACTTCAGCTTCCAACGGAATCATGACAAGTGGACACGACGTCATCCCCCTTCAAACCCCGGGA
AGGAAATGGTACATTTGTGGTGTCGGAAAGCACTGCGAGTCAAGAAACATGAAGCTTGTTGTTAGGGCTGGAATTTTATTATACATGATCCTTACACGTGATCCTAACCAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCACATCCCGTATGAGCATTAGCTTCGTAGCAACATTTTTTGTTCTTGCGACATCGATCTACGCTAAGGAATACATCGTCGGGGATGAAAATGGTTGGAAACTCGATTTTGATTAC
CAAACTTGGGCCAAGGACAAAGTATTCTTCGTTGGAGATACCCTTG
TATTCAACTATGCGGCTGGTGCCCACACTGTCGCAAAAGTCAATGGAACAAGTTTCCAACAATGTAGCACTTCA
GCTTCCAACGGAATCATGACAAGTGGACACGACGTCATCCCCCTTCAAACCCCGGGAAGGAAATGGTACATTTGTGGTGTCGGAAAGCACTGCGAGTCAAGAAACATGAAGCTTGTTGTT
AGGGCTGGAATTTTATTATACATGATCCTTACACGTGATCCTAACCAGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCACAT CCCGTATGAG CATTAGCTTC GTAGCAACAT TTTTTGTTCT TGCGACATCG ATCTACGCTA AGGAATACAT CGTCGGGGAT GAAAATGGTT GGAAACTCGA TTTTGATTAC  CAAACTTGGG CCAAGGACAA AGTATTCTTC GTTGGAGATA CCCTTGTATT CAACTATGCG GCTGGTGCCC ACACTGTCGC AAAAGTCAAT GGAACAAGTT TCCAACAATG TAGCACTTCA  GCTTCCAACG GAATCATGAC AAGTGGACAC GACGTCATCC CCCTTCAAAC CCCGGGAAGG AAATGGTACA TTTGTGGTGT CGGAAAGCAC TGCGAGTCAA GAAACATGAA GCTTGTTGTT 
AGGGCTGGAA TTTTATTATA CATGATCCTT ACACGTGATC CTAACCAGTG A 

Retrieve as FASTA