Entry information : HaSTC11HanXRQChr03g0087461
Entry ID 14586
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC11HanXRQChr03g0087461
Name HaSTC11HanXRQChr03g0087461
Class Stellacyanin    [Orthogroup: STC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC11
start..stop
S start..stop
HaSTC09 210 2e-70 49..192 11..158
HaSTC07 209 3e-70 49..192 11..157
HaSTC08 204 4e-68 71..192 36..157
HaSTC29 158 1e-49 88..198 90..202
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150223934..150224035 102 N° 2 150224177..150224671 495  
join(150223934..150224035,150224177..150224671)


exon

Literature and cross-references HaSTC11HanXRQChr03g0087461
DNA ref. HanXRQ genome:   HanXRQChr03 (150223934..150224671)
Protein sequence: HaSTC11HanXRQChr03g0087461
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   198
PWM (Da):   %s   21579.49 Transmb domain:   %s   i48-67o178-197i
PI (pH):   %s   10.56
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQKNTLWGMKMVGNSTLIIKLGPRIKFSTSEIPLQLKNHFVCICDLDVVATFVTLLNSVAIFATIFGRKIVHFSFPRRLINVILYNSLDTVFNYAAGVHNVAKVNGTGFQQCSTSASNGIMTSRRDVVPLQTPGRKWYICGVGKHCESRNMKLVITVLPQTWAPAPSPIATSTSGKLAVPTIYGFVVGLFGSLLLLFV*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAAGAATACATTGTGGGGGATGAAAATGGTTGGAAACTCGACTTTGATTATCAAACTTGGGCCAAGGATAAAGTTTTCTACGTCGGAGATACCCTTGGTATGTTATATATCCCCG
TCATTTTATTTAGATTTTCTACTACAAAACTAGGTATTTGCAACCATCAATTTGGTCACAAATCGGTAACAAAAAAAACTTCGCAACATCTCAGTCACCAATCTGTTTTGCGACCGGTTT
TAGCAACTAAAAAACCACTTTGTTTGTATCTGTGACTTGGATGTGGTCGCTACTTTTGTGACACTTTTAAATTCTGTCGCAATCTTTGCGACCATTTTCGGTCGCAAAATCGTGCATTTC
TCGTTCCCACGACGTTTAATAAATGTAATCCTTTACAATTCTCTTGATACAGTTTTCAACTATGCGGCTGGTGTTCACAACGTTGCGAAAGTCAACGGCACCGGTTTCCAACAATGTAGC
ACTTCAGCTTCCAATGGAATCATGACAAGTAGACGAGATGTTGTCCCCCTACAAACCCCTGGAAGGAAATGGTACATTTGTGGTGTCGGAAAGCATTGCGAGTCGAGAAACATGAAGCTT
GTCATCACCGTTCTACCTCAAACATGGGCTCCTGCTCCAAGCCCGATAGCGACATCCACATCGGGCAAGTTGGCGGTACCAACTATCTATGGATTTGTAGTTGGATTATTCGGCAGTCTT
TTATTGCTCTTTGTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAAGAATACATTGTGGGGGATGAAAATGGTTGGAAACTCGACTTTGATTATCAAACTTGGGCCAAGGATAAAGTTTTCTACGTCGGAGATACCCTTGCAACTAAAAAACCACTTT
GTTTGTATCTGTGACTTGGATGTGGTCGCTACTTTTGTGACACTTTTAAATTCTGTCGCAATCTTTGCGACCATTTTCGGTCGCAAAATCGTGCATTTCTCGTTCCCACGACGTTTAATA
AATGTAATCCTTTACAATTCTCTTGATACAGTTTTCAACTATGCGGCTGGTGTTCACAACGTTGCGAAAGTCAACGGCACCGGTTTCCAACAATGTAGCACTTCAGCTTCCAATGGAATC
ATGACAAGTAGACGAGATGTTGTCCCCCTACAAACCCCTGGAAGGAAATGGTACATTTGTGGTGTCGGAAAGCATTGCGAGTCGAGAAACATGAAGCTTGTCATCACCGTTCTACCTCAA
ACATGGGCTCCTGCTCCAAGCCCGATAGCGACATCCACATCGGGCAAGTTGGCGGTACCAACTATCTATGGATTTGTAGTTGGATTATTCGGCAGTCTTTTATTGCTCTTTGTTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAAGA ATACATTGTG GGGGATGAAA ATGGTTGGAA ACTCGACTTT GATTATCAAA CTTGGGCCAA GGATAAAGTT TTCTACGTCG GAGATACCCT TGCAACTAAA AAACCACTTT  GTTTGTATCT GTGACTTGGA TGTGGTCGCT ACTTTTGTGA CACTTTTAAA TTCTGTCGCA ATCTTTGCGA CCATTTTCGG TCGCAAAATC GTGCATTTCT CGTTCCCACG ACGTTTAATA  AATGTAATCC TTTACAATTC TCTTGATACA GTTTTCAACT ATGCGGCTGG TGTTCACAAC GTTGCGAAAG TCAACGGCAC CGGTTTCCAA CAATGTAGCA CTTCAGCTTC CAATGGAATC  ATGACAAGTA GACGAGATGT TGTCCCCCTA CAAACCCCTG GAAGGAAATG GTACATTTGT GGTGTCGGAA AGCATTGCGA GTCGAGAAAC ATGAAGCTTG TCATCACCGT TCTACCTCAA 
ACATGGGCTC CTGCTCCAAG CCCGATAGCG ACATCCACAT CGGGCAAGTT GGCGGTACCA ACTATCTATG GATTTGTAGT TGGATTATTC GGCAGTCTTT TATTGCTCTT TGTTTAA 

Retrieve as FASTA