Entry information : HaSTC12HanXRQChr04g0110241
Entry ID 14587
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC12HanXRQChr04g0110241
Name HaSTC12HanXRQChr04g0110241
Class Stellacyanin    [Orthogroup: STC006]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC12
start..stop
S start..stop
ThasSTC02 171 5e-55 1..125 1..123
AtSTC02 167 1e-53 6..131 5..127
ThasSTC03 146 4e-45 10..183 9..179
HaSTC02 141 4e-43 10..180 11..180
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 94888302..94888479 178 N° 2 94887036..94887427 392  
complement(join(94887036..94887427,94888302..94888479))


exon

Literature and cross-references HaSTC12HanXRQChr04g0110241
DNA ref. HanXRQ genome:   HanXRQChr04 (94888479..94887036)
Protein sequence: HaSTC12HanXRQChr04g0110241
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   189 (164)
PWM (Da):   %s   19872.78 (17323.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.33 (8.82) Peptide Signal:   %s   cut: 26 range:26-189
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKVAVVATLMAMVVCGSLMETAIAAVYTVGDSSGWTTIGNVDYKQWAAIKTFKVGDTIVFTYNKQFHNVMQVKHADYRSCNASTPIATHSTGNDSIVIKTYGHHFYMCAVPGHCQAGQKVDINVERDSSTMAPSSSISNPPTSSFLPSPSSAPTSSTLSKPNSVGKATSSTISHITVALAIAMFVGIM

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAGGTGGCAGTGGTTGCAACGTTGATGGCCATGGTGGTTTGTGGTTCATTGATGGAGACAGCCATTGCAGCAGTGTACACAGTCGGAGACTCATCTGGATGGACCACCATTGGT
AATGTTGATTACAAACAGTGGGCTGCTATTAAAACCTTCAAAGTTGGGGATACTATAG
GTATGTATGTTTATCTCCTACTCTTTTGTCTTCTTCAGGTTTGGTTTCATTTGGTCTGTTAT
ATGTTGCATAAACACCCGAGTTGAAGCATCGTTTTCGTCATTTGAGGCAGTATTACATCAAATAACTCATATTCTCGTTCTAATTAAAAGCCCTGAAACATCAGTTTGTAATTCGGAAAA
AATCTTAACTCCGTTAAGCTATATTTAATGCAGACTATTATCTGCCAAAAGTGAATCACTTCAGATTATTATCGGTCAGTAACTGAGTTGAGATTATTATCTACCAAATTGAGAAAACTG
AGATTATTTAAATCCAATTTGCCTCAAACTGCACAAATTAGTATAAATTCAAATTCAAATTTGAATTGAATTTCTTATTTGTTAGTATTAATAATTGCAGCACAAAGTGGTGCTTCTGTA
TCATCATAGTGAATAATTGCCTCTCATAGTGCTCCTTTCTCGTCCAATACATAAAGTATTTTTTTTTTCCATTTTCTGCATTTATTTCTATTTGAAATTCAAATAAATAAAAGAAGTTTT
ATTTGAAATTCAAATAAATAAAAGAAGTTTCATGTCCTCATCGTTTTCTGTTTTTTTTAACTATGTTTCTGTTTAAATTAGACCATTGATTTTGCTTTTGATTAACAACAAAGCTAAAAA
AAAATCTTAGGGGTTCGGGCCTTTTTGAGTGGCCTATGCCATGCCCAAGATTCCTTTTCTTTTTCAGTTTTATACTAGTGAAACAATGTGGTTTATTTAATTAAGTCTTTCATATTTAAT
ACAAGAAACTTATATACAACATGTTTTTCTATGACACCATATCATGTTACTTACATTAATAACATGTCATTCTAATAATTTTGTTATTCTAGTATTCACATACAACAAGCAGTTTCACAA
TGTGATGCAAGTCAAACATGCCGACTATAGATCCTGCAACGCCTCAACACCCATTGCAACCCACTCTACTGGCAATGACTCGATTGTCATCAAGACATACGGCCACCACTTTTACATGTG
TGCGGTCCCAGGACATTGCCAAGCCGGACAAAAGGTTGACATTAACGTCGAACGCGATTCTTCTACAATGGCTCCATCTTCATCGATATCAAATCCACCAACATCGTCTTTTTTGCCATC
TCCATCCTCTGCCCCCACAAGCTCCACATTAAGTAAGCCTAATTCGGTAGGCAAAGCAACTTCATCAACTATATCGCATATTACGGTAGCGTTGGCTATAGCTATGTTTGTTGGTATTAT
GTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAGGTGGCAGTGGTTGCAACGTTGATGGCCATGGTGGTTTGTGGTTCATTGATGGAGACAGCCATTGCAGCAGTGTACACAGTCGGAGACTCATCTGGATGGACCACCATTGGT
AATGTTGATTACAAACAGTGGGCTGCTATTAAAACCTTCAAAGTTGGGGATACTATAG
TATTCACATACAACAAGCAGTTTCACAATGTGATGCAAGTCAAACATGCCGACTATAGATCC
TGCAACGCCTCAACACCCATTGCAACCCACTCTACTGGCAATGACTCGATTGTCATCAAGACATACGGCCACCACTTTTACATGTGTGCGGTCCCAGGACATTGCCAAGCCGGACAAAAG
GTTGACATTAACGTCGAACGCGATTCTTCTACAATGGCTCCATCTTCATCGATATCAAATCCACCAACATCGTCTTTTTTGCCATCTCCATCCTCTGCCCCCACAAGCTCCACATTAAGT
AAGCCTAATTCGGTAGGCAAAGCAACTTCATCAACTATATCGCATATTACGGTAGCGTTGGCTATAGCTATGTTTGTTGGTATTATGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GATAAAGACC CCCTCACACA TACATACATA CAATATACTT ATAAATAGCT TTAGAATCTT GAGCTATCTC TAAGCCTTCT CTCTAAGACA AGTTATATAT ATTAAGTATT CTCTAAGACA  AGTTATATAC ATATCAAGTA TAACAGAAAT GGAGAAGGTG GCAGTGGTTG CAACGTTGAT GGCCATGGTG GTTTGTGGTT CATTGATGGA GACAGCCATT GCAGCAGTGT ACACAGTCGG  AGACTCATCT GGATGGACCA CCATTGGTAA TGTTGATTAC AAACAGTGGG CTGCTATTAA AACCTTCAAA GTTGGGGATA CTATAGTATT CACATACAAC AAGCAGTTTC ACAATGTGAT  GCAAGTCAAA CATGCCGACT ATAGATCCTG CAACGCCTCA ACACCCATTG CAACCCACTC TACTGGCAAT GACTCGATTG TCATCAAGAC ATACGGCCAC CACTTTTACA TGTGTGCGGT  CCCAGGACAT TGCCAAGCCG GACAAAAGGT TGACATTAAC GTCGAACGCG ATTCTTCTAC AATGGCTCCA TCTTCATCGA TATCAAATCC ACCAACATCG TCTTTTTTGC CATCTCCATC  CTCTGCCCCC ACAAGCTCCA CATTAAGTAA GCCTAATTCG GTAGGCAAAG CAACTTCATC AACTATATCG CATATTACGG TAGCGTTGGC TATAGCTATG TTTGTTGGTA TTATGTGAGG  GTTTGATCCA TCTGTCTCAG TGAACGTCAT TGGAGGGGAA CTACTCACAT TTTGTGTTGA TTTCTTATGA AAATAGGCAT GTTGATGTTC TTATGTAACG GAGATTTTTC TTTTATATGT 
AATTGGCTAG ACCCACATAT TCAATAATAA CAAAGTTCCA AGATATGCAA TGCACTACTA GAAAATCTGC CAATTCTTAT CCGTTGTTTA A 

Retrieve as FASTA