Entry information : HaSTC15HanXRQChr06g0177951
Entry ID 14590
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC15HanXRQChr06g0177951
Name HaSTC15HanXRQChr06g0177951
Class Stellacyanin    [Orthogroup: STC003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC15
start..stop
S start..stop
HaSTC16 244 4e-84 8..123 10..125
HaSTC22 182 1e-59 8..127 10..128
HaSTC21 172 1e-53 8..122 10..124
HaCRX04 90 8e-24 8..131 5..134
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45691620..45691640 21 N° 2 45689483..45689639 157 N° 3 45689068..45689408 341  
complement(join(45689068..45689408,45689483..45689639,45691620..45691640))


exon

Literature and cross-references HaSTC15HanXRQChr06g0177951
DNA ref. HanXRQ genome:   HanXRQChr06 (45691640..45689068)
Protein sequence: HaSTC15HanXRQChr06g0177951
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172 (145)
PWM (Da):   %s   17931.43 (14950.7) Transmb domain:   %s   i7-25o
PI (pH):   %s   6.46 (6.46) Peptide Signal:   %s   cut: 28 range:28-172
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPTYDILNLSIIILIATLVAQATWVRAAEHIVGDDKGWTEGVDYHAWATAREFKPGDKLVFNYDPAKYRVLFVSYCQYKWCNTEGSVFPIKDEAILGAAGDYTFISNRDECLKGMKLHVHVRRPPGECPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCSGGCPCPA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTACATATGATATATTGGTTTTTTTTTAATTGTTAGGTGTTTCAGCCATTTTCTTATAAAGTTTTTTATTGCAATTCAAGATCAATGAGTTTTATAAATTAACGAACTATTACTTT
TTCTGAATGAATACTAATACTTGTTTATATGGTTGATCAGTATTATGAGAAGCTTTGGAATCTAAAGATTTCGAATTCAGAATATGTTACTTATTACACAACGTTTTGTTAACATTTAGA
TTATGTTTTGGATTGTAGTTATTATTGAAGTTATAATATTATGATTTCTACATTTATAGCTTTATGGAGCTTTTATTTTATATTTTGAGTTGTAAATAATGTGATTTTTGTGGCAAAATT
ATGTGCCACTTAAAAGAGTACAATTATTTAACTAGAAACAGTTTTTAACGCAAAAGGTTTTTATATTTTGGCAAAAAAAAAAGTAACACTACAACTAATATAAATCTGTAAGAGCATTCA
CATTTATTCCACTATATTTTCACCCTAAATTACACAAAAAACACTACATATTCTCTTTCCTTTTCAATTAAATAATATTTTTTATACCTTTATCATTAACTTTTCTCTCTCCTTCACTCA
CAACCACTTTCAAAATATATTAAAAAATTATAGGCGGTGAACATTGTCCCCCGAAATATACAGATGAACAGTAACATTTTCTCTCTCCTCCACTCACAACCACTTTTTATACTTTTATAT
CCTAACCATTGAAGTAGTGTGACCAATTGCAGAATCCATCCTACAATTCAACAAAATTAAGTATTTTACATGATAATATTTTACATGATAAGGTAGGAACATATACAAATAGACTTAAAT
CTAAAAATGTAAGAACCAATATAACATTGCCACATGGCATATGGTTTAATTACCGGTAAGGGTATCTAAGTCGTATATTCATGAGCTGGTGTTGGTAAATCATTAATTTCATGGATTTCA
TTATTCAAAATATCAAATCGCAAATCATGCAACCTATAATTCCATATTTTTAATTCAATTTTATTTTAGGGATTCAGATTCTTAAGACAATGAAGGCAACGAGTCTAAATATTCATGCTC
TTCATTCAATTATATCAGTTATTCATTTTTAATTTATCACTGAATGAGCCTAATTAGGTGATAACATTCAATTGACATGCAACCTATTAGTAAAAATATCAATGGTTTTTGTCACGTCGG
AGAATTTCAAAGATATTCTGATTTTTTTTATCATCATTTTTTATGATGTGTGAGGATATCAATCACTTTCATAATTCATGATAATAAAAATAGTAATTAAACATTAACAAAAAAAAAATA
AAAACGTATATTTGAAAGGCAAAACTACAATACCTACTCCTAATATCTAAAATATTTCTCTTTAAATAGATTTGAACTCTCACCACATAAGATATAAACATCAATACAACATTCTTGATA
ACATTATTAACTATGTGGTATATAAGCTATAAATATTTTGAATACTTAAAATATTGATGATAGTAAAAAGAATACTAAAATTTGAAAATGATATATTAAAATTTTAATTTAGACTCATGA
ACTTCTTTAAAAAAATAATAATAACAATAACACTATTGTCCTGAATTTAATTAATAAACAATAATGATAATTATTATGGTAAACTGATAATTAATAACAGTAATGTTGATTGTTATGGTA
ACATTGATCATAATTAGATTGTTTCCTAATGTATCCATGTTTATTTAGAATAAAACTAGAAAATAAAAAATATTTTAAATCTTGCAAGTCTATTTATGATCAAAAGCTGTGAATAAAAAA
CCATTCTTTAAAGAAATAGATAGCTACTTACTTACTTTAGTATGCATACCAAATTTAGAATATGTGAGCGTGTCATTAGGCATGGAAGTATCTTTTTCTTCAATTATAATGGTGGAGAGG
ATTTGTAGCATGCTTCCTTTCTGAATAAATTGGAAGTTGAAGTTGTATCCTAGAATGAATTGTACCAAAATGGCTAACAAGAATTTGAGCATCATCATCCTCATAGCAACCCTAGTGGCT
CAAGCTACTTGGGTTAGAGCAGCAGAGCATATAGTTGGAGATGATAAAGGTTGGACCGAGGGTGTCGATTACCATGCATGGGCTACGGCTCGGGAATTCAAGCCGGGAGACAAACTTG
GT
AAATATTACACATGCTTTGTTGATAATTATATGTCTATGTCTTGCAGCAAGCTAACTATGTTGTTGGTTTAGTGTTCAATTACGATCCAGCAAAATATAGGGTATTATTCGTAAGTTATT
GCCAATACAAGTGGTGTAATACCGAGGGATCAGTTTTTCCAATAAAGGATGAGGCCATCCTAGGAGCAGCAGGCGACTATACGTTTATTTCTAATCGAGATGAGTGTTTGAAAGGTATGA
AGCTTCATGTCCATGTCAGGCGGCCACCTGGAGAGTGTCCCGGTGGATGTCCCGGAGGGTGTCCGGGTGGGTGTCCCGGAGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGAGGAT
GTCCCGGTGGATGTCCCGGAGGGTGTTCCGGAGGGTGTCCATGTCCTGCATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTACATATGATATATTGAATTTGAGCATCATCATCCTCATAGCAACCCTAGTGGCTCAAGCTACTTGGGTTAGAGCAGCAGAGCATATAGTTGGAGATGATAAAGGTTGGACCGAG
GGTGTCGATTACCATGCATGGGCTACGGCTCGGGAATTCAAGCCGGGAGACAAACTTG
TGTTCAATTACGATCCAGCAAAATATAGGGTATTATTCGTAAGTTATTGCCAATACAAGTGG
TGTAATACCGAGGGATCAGTTTTTCCAATAAAGGATGAGGCCATCCTAGGAGCAGCAGGCGACTATACGTTTATTTCTAATCGAGATGAGTGTTTGAAAGGTATGAAGCTTCATGTCCAT
GTCAGGCGGCCACCTGGAGAGTGTCCCGGTGGATGTCCCGGAGGGTGTCCGGGTGGGTGTCCCGGAGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGAGGATGTCCCGGTGGATGT
CCCGGAGGGTGTTCCGGAGGGTGTCCATGTCCTGCATAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTACAT ATGATATATT GAATTTGAGC ATCATCATCC TCATAGCAAC CCTAGTGGCT CAAGCTACTT GGGTTAGAGC AGCAGAGCAT ATAGTTGGAG ATGATAAAGG TTGGACCGAG  GGTGTCGATT ACCATGCATG GGCTACGGCT CGGGAATTCA AGCCGGGAGA CAAACTTGTG TTCAATTACG ATCCAGCAAA ATATAGGGTA TTATTCGTAA GTTATTGCCA ATACAAGTGG  TGTAATACCG AGGGATCAGT TTTTCCAATA AAGGATGAGG CCATCCTAGG AGCAGCAGGC GACTATACGT TTATTTCTAA TCGAGATGAG TGTTTGAAAG GTATGAAGCT TCATGTCCAT  GTCAGGCGGC CACCTGGAGA GTGTCCCGGT GGATGTCCCG GAGGGTGTCC GGGTGGGTGT CCCGGAGGGT GTCCCGGTGG GTGTCCCGGT GGGTGTCCCG GAGGATGTCC CGGTGGATGT  CCCGGAGGGT GTTCCGGAGG GTGTCCATGT CCTGCATAGC CATAATGTCC TGCAAAGCCA TCATGTCCTC CATGATACAA GCATAAAACT CTAAGCTTTG AAGATGGCAT GTCTTGTTTC 
TTTTTTTATT TGTTGTTTGT TAATAAATGT TAATATCTGA TCAATAATTA TATCATATGT ATTGGAGAAT AATGAATTTA AGATTTATCA TGAT 

Retrieve as FASTA