Entry information : HaSTC19HanXRQChr10g0282431
Entry ID 14594
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC19HanXRQChr10g0282431
Name HaSTC19HanXRQChr10g0282431
Class Stellacyanin    [Orthogroup: STC007]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC19
start..stop
S start..stop
HaSTC02 146 6e-45 8..165 2..158
AtSTC02 133 1e-39 27..137 14..126
ThasSTC02 126 7e-37 18..152 9..166
HaSTC12 123 7e-36 17..145 10..144
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24999794..24999992 199 N° 2 24998662..24999089 428  
complement(join(24998662..24999089,24999794..24999992))


exon

Literature and cross-references HaSTC19HanXRQChr10g0282431
DNA ref. HanXRQ genome:   HanXRQChr10 (24999992..24998662)
Protein sequence: HaSTC19HanXRQChr10g0282431
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   208 (182)
PWM (Da):   %s   22061.98 (19149.4) Transmb domain:   %s   i13-35o
PI (pH):   %s   7.05 (7.05) Peptide Signal:   %s   cut: 33 range:27-208
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFFLENLTAKKMLLFVLLMIDIGSSVMMVTGEVYKVGDSAGWTADSNSNYADWASSKTFHVDDVLLFEYNATKDNVILVTLPDFRSCNTSAPLKMYNSGNDSFTIKSGGHYFFTSNFSGHCQGGQKLDVRVLKPSSPPTTPPPSPTTSPSLSPSPSASHAAAGPVESKGVAPSPTQSKGATYDPKWLLVNTLGVTISSLVVLVHGYA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTCTTCTTGGAAAATTTAACGGCGAAAAAAATGTTGTTGTTTGTGCTACTGATGATCGACATAGGTTCATCAGTCATGATGGTTACCGGAGAAGTGTACAAGGTTGGTGATTCG
GCTGGTTGGACTGCGGATTCCAACTCGAATTATGCAGATTGGGCGTCTTCCAAGACCTTTCATGTTGACGATGTTCTTT
GTGAGTACTTTCGTCATTAATATTGTTATATACATAATTAT
TAGCACATAAAGGTCGAGTAAAGTATCTTTAACCGTCCCCATTTGAACCGGCTGGTTATGAGTTGGACCGGTTTAGTTTACAAACCAAACCAGTGGTTGGACCGGGTTAAAAAAAAGATT
CGTTCAAAAGTGATAAATAAACACATGTGTGGGTGGTTGTGTGTGTCAATTATTAATTATAATGATGTCGTATCTATCTATAGTGTTTTGTTTGTTTATTCGGTTTTGAATTGGTTTTGG
TCTAACCGATAACCAAACCTATTTGAATTAGAAATGTGTCTTACTAAACCGAATTAAACCGATTTATTCAATTTGGTCATCCGATTAAACTGGTTATTATTCGGTTTGGTTATCCAGATA
AGCAAGGTTTGTAGATCCGGTAACCAAACAAAAAATCAAATAAGCAATTTTGATAGGAACCAAACCGAATAACCATAAAAGATTTTGATTCGGTTTATCGGTTACGGATATAATTCAATT
TTTTTTTTGTTACGACTAATTTTGCACACCCCACTCATCTGTGTTTTGAAACCGGTCCAACTAGTAAATCAGTAGGGTGACTGGTTCGATAACCTTATGATAACAATTTTACTTTTTGTT
CATTAGTCATTAAATTATCAAAATTAGTTTTATAAAATATAATGAACGTTTATGATGAAACAGTGTTCGAGTACAACGCAACCAAGGATAATGTGATACTCGTAACTCTCCCTGATTTCC
GGTCATGCAACACCTCGGCTCCTTTAAAAATGTACAACTCGGGCAATGACTCATTCACTATCAAGTCAGGAGGTCATTACTTCTTCACTAGCAATTTTTCGGGCCATTGCCAAGGCGGTC
AAAAGCTCGATGTCAGGGTCCTCAAACCATCTTCTCCACCCACCACCCCACCGCCAAGTCCCACCACCAGCCCGAGCCTGAGCCCGAGCCCAAGTGCATCCCATGCAGCAGCGGGACCCG
TAGAGTCAAAGGGGGTAGCACCTAGCCCAACTCAAAGCAAGGGGGCAACATATGATCCAAAGTGGTTGCTTGTGAACACCCTTGGTGTGACCATAAGTAGTCTTGTAGTATTGGTTCATG
GTTATGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTCTTCTTGGAAAATTTAACGGCGAAAAAAATGTTGTTGTTTGTGCTACTGATGATCGACATAGGTTCATCAGTCATGATGGTTACCGGAGAAGTGTACAAGGTTGGTGATTCG
GCTGGTTGGACTGCGGATTCCAACTCGAATTATGCAGATTGGGCGTCTTCCAAGACCTTTCATGTTGACGATGTTCTTT
TGTTCGAGTACAACGCAACCAAGGATAATGTGATACTCGTA
ACTCTCCCTGATTTCCGGTCATGCAACACCTCGGCTCCTTTAAAAATGTACAACTCGGGCAATGACTCATTCACTATCAAGTCAGGAGGTCATTACTTCTTCACTAGCAATTTTTCGGGC
CATTGCCAAGGCGGTCAAAAGCTCGATGTCAGGGTCCTCAAACCATCTTCTCCACCCACCACCCCACCGCCAAGTCCCACCACCAGCCCGAGCCTGAGCCCGAGCCCAAGTGCATCCCAT
GCAGCAGCGGGACCCGTAGAGTCAAAGGGGGTAGCACCTAGCCCAACTCAAAGCAAGGGGGCAACATATGATCCAAAGTGGTTGCTTGTGAACACCCTTGGTGTGACCATAAGTAGTCTT
GTAGTATTGGTTCATGGTTATGCTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTCT TCTTGGAAAA TTTAACGGCG AAAAAAATGT TGTTGTTTGT GCTACTGATG ATCGACATAG GTTCATCAGT CATGATGGTT ACCGGAGAAG TGTACAAGGT TGGTGATTCG  GCTGGTTGGA CTGCGGATTC CAACTCGAAT TATGCAGATT GGGCGTCTTC CAAGACCTTT CATGTTGACG ATGTTCTTTT GTTCGAGTAC AACGCAACCA AGGATAATGT GATACTCGTA  ACTCTCCCTG ATTTCCGGTC ATGCAACACC TCGGCTCCTT TAAAAATGTA CAACTCGGGC AATGACTCAT TCACTATCAA GTCAGGAGGT CATTACTTCT TCACTAGCAA TTTTTCGGGC  CATTGCCAAG GCGGTCAAAA GCTCGATGTC AGGGTCCTCA AACCATCTTC TCCACCCACC ACCCCACCGC CAAGTCCCAC CACCAGCCCG AGCCTGAGCC CGAGCCCAAG TGCATCCCAT  GCAGCAGCGG GACCCGTAGA GTCAAAGGGG GTAGCACCTA GCCCAACTCA AAGCAAGGGG GCAACATATG ATCCAAAGTG GTTGCTTGTG AACACCCTTG GTGTGACCAT AAGTAGTCTT 
GTAGTATTGG TTCATGGTTA TGCTTAG 

Retrieve as FASTA