Entry information : HaSTC21HanXRQChr13g0389441
Entry ID 14596
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC21HanXRQChr13g0389441
Name HaSTC21HanXRQChr13g0389441
Class Stellacyanin    [Orthogroup: STC003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC21
start..stop
S start..stop
HaSTC22 224 1e-73 1..127 1..127
HaSTC16 210 6e-68 1..125 1..125
HaSTC15 172 1e-53 18..125 16..123
HaCRX04 102 8e-27 6..136 1..134
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16549211..16549394 184 N° 2 16548289..16549136 848  
complement(join(16548289..16549136,16549211..16549394))


exon

Literature and cross-references HaSTC21HanXRQChr13g0389441
DNA ref. HanXRQ genome:   HanXRQChr13 (16549394..16548289)
Protein sequence: HaSTC21HanXRQChr13g0389441
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343 (314)
PWM (Da):   %s   30991.88 (27823.2) Transmb domain:   %s   i13-30o
PI (pH):   %s   7.37 (6.86) Peptide Signal:   %s   cut: 30 range:30-343
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNCTKMANKNLSIIILIATLVAQATWVRAAEHIVGDDKGWAEGVDYEAWAKGREFKQGDKLVFNYDPAKYMVLYVTMDKYKCCCAAGPIMGIKKDVILGGVGDYPFIANRNECLKGMKLLVTVKPSGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPCPAKP

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTGTACCAAAATGGCTAACAAGAATTTGAGCATCATCATCCTCATAGCAACACTAGTGGCTCAAGCTACTTGGGTTAGAGCAGCAGAGCATATAGTTGGAGATGATAAAGGTTGG
GCCGAGGGTGTCGATTACGAAGCATGGGCTAAGGGTCGGGAATTCAAGCAGGGAGACAAACTTG
GTAAATATTACACATGCTTTGTTGATAATTATATGTCTATGTCTTGCAGCAAGCTA
ACTATGTTGTTGGTTTAGTGTTCAATTACGACCCAGCAAAATATATGGTATTATACGTCACTATGGACAAATACAAGTGCTGTTGTGCTGCGGGACCAATTATGGGCATAAAGAAAGATG
TCATCTTAGGAGGAGTGGGCGACTATCCGTTTATTGCTAATCGAAATGAGTGTTTGAAAGGTATGAAGCTTCTTGTCACTGTCAAGCCATCTGGTGGGTGTCCCGGTGGGTGTCCCGGTG
GGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGATGTCCCGGTGGGTGTCCCGGAGGGTGTCCCGGAGGGTGTCCGGGTGGGTGTCCAGGAGGGTGTCCCGGTG
GATGTCCCGGTGGATGTCCGGGTGGGTGTCCAGGAGGGTGTCCCGGTGGGTGTCCCGGAGGGTGTCCCGGGGGGTGTCCCGGAGGGTGCCCCGGTGGGTGTCCCGGAGGGTGTCCCGGAG
GCTGTCCCGGAGGGTGCCCCGGTGGGTGTCCCGGAGGCTGTCCCGGAGGCTGTCCTGGTGGGTGCCCCGGTGGGTGCCCCGGTGGGTGCCCCGGTGGGTGCCCCGGTGGGTGCCCCGGTG
GGTGCCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGAGGGTGTCCCGGAGGGTGTCCCGGAGGGTGTCCCGGAG
GGTGTCCCGGAGGGTGTCCCGGTGGGTGTCCCGGAGGGTGTCCCGGAGGGTGTCCCGGAGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGATGTCCCGGAGGATGTCCCGGGG
GGTGTCCATGTCCTGCAAAGCCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTGTACCAAAATGGCTAACAAGAATTTGAGCATCATCATCCTCATAGCAACACTAGTGGCTCAAGCTACTTGGGTTAGAGCAGCAGAGCATATAGTTGGAGATGATAAAGGTTGG
GCCGAGGGTGTCGATTACGAAGCATGGGCTAAGGGTCGGGAATTCAAGCAGGGAGACAAACTTG
TGTTCAATTACGACCCAGCAAAATATATGGTATTATACGTCACTATGGACAAATAC
AAGTGCTGTTGTGCTGCGGGACCAATTATGGGCATAAAGAAAGATGTCATCTTAGGAGGAGTGGGCGACTATCCGTTTATTGCTAATCGAAATGAGTGTTTGAAAGGTATGAAGCTTCTT
GTCACTGTCAAGCCATCTGGTGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGATGTCCCGGTGGGTGTCCCGGAGGG
TGTCCCGGAGGGTGTCCGGGTGGGTGTCCAGGAGGGTGTCCCGGTGGATGTCCCGGTGGATGTCCGGGTGGGTGTCCAGGAGGGTGTCCCGGTGGGTGTCCCGGAGGGTGTCCCGGGGGG
TGTCCCGGAGGGTGCCCCGGTGGGTGTCCCGGAGGGTGTCCCGGAGGCTGTCCCGGAGGGTGCCCCGGTGGGTGTCCCGGAGGCTGTCCCGGAGGCTGTCCTGGTGGGTGCCCCGGTGGG
TGCCCCGGTGGGTGCCCCGGTGGGTGCCCCGGTGGGTGCCCCGGTGGGTGCCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGTGGG
TGTCCCGGAGGGTGTCCCGGAGGGTGTCCCGGAGGGTGTCCCGGAGGGTGTCCCGGAGGGTGTCCCGGTGGGTGTCCCGGAGGGTGTCCCGGAGGGTGTCCCGGAGGGTGTCCCGGTGGG
TGTCCCGGTGGGTGTCCCGGTGGATGTCCCGGAGGATGTCCCGGGGGGTGTCCATGTCCTGCAAAGCCATGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTGTA CCAAAATGGC TAACAAGAAT TTGAGCATCA TCATCCTCAT AGCAACACTA GTGGCTCAAG CTACTTGGGT TAGAGCAGCA GAGCATATAG TTGGAGATGA TAAAGGTTGG  GCCGAGGGTG TCGATTACGA AGCATGGGCT AAGGGTCGGG AATTCAAGCA GGGAGACAAA CTTGTGTTCA ATTACGACCC AGCAAAATAT ATGGTATTAT ACGTCACTAT GGACAAATAC  AAGTGCTGTT GTGCTGCGGG ACCAATTATG GGCATAAAGA AAGATGTCAT CTTAGGAGGA GTGGGCGACT ATCCGTTTAT TGCTAATCGA AATGAGTGTT TGAAAGGTAT GAAGCTTCTT  GTCACTGTCA AGCCATCTGG TGGGTGTCCC GGTGGGTGTC CCGGTGGGTG TCCCGGTGGG TGTCCCGGTG GGTGTCCCGG TGGGTGTCCC GGTGGATGTC CCGGTGGGTG TCCCGGAGGG  TGTCCCGGAG GGTGTCCGGG TGGGTGTCCA GGAGGGTGTC CCGGTGGATG TCCCGGTGGA TGTCCGGGTG GGTGTCCAGG AGGGTGTCCC GGTGGGTGTC CCGGAGGGTG TCCCGGGGGG  TGTCCCGGAG GGTGCCCCGG TGGGTGTCCC GGAGGGTGTC CCGGAGGCTG TCCCGGAGGG TGCCCCGGTG GGTGTCCCGG AGGCTGTCCC GGAGGCTGTC CTGGTGGGTG CCCCGGTGGG  TGCCCCGGTG GGTGCCCCGG TGGGTGCCCC GGTGGGTGCC CCGGTGGGTG CCCCGGTGGG TGTCCCGGTG GGTGTCCCGG TGGGTGTCCC GGTGGGTGTC CCGGTGGGTG TCCCGGTGGG  TGTCCCGGAG GGTGTCCCGG AGGGTGTCCC GGAGGGTGTC CCGGAGGGTG TCCCGGAGGG TGTCCCGGTG GGTGTCCCGG AGGGTGTCCC GGAGGGTGTC CCGGAGGGTG TCCCGGTGGG  TGTCCCGGTG GGTGTCCCGG TGGATGTCCC GGAGGATGTC CCGGGGGGTG TCCATGTCCT GCAAAGCCAT GATGTCCTCC ATGATACAAG CATAAAACTC TAAGCTTCGG CATGTCTTGT 
TTCTTTTTTT ATTTGTTGTT TGTTAATAAA TGTTAATATC TGAACAATAA TTATATCATA TGTATTGGAG AATAATGAAT TTAAGATTTA TCATGATCA 

Retrieve as FASTA