Entry information : HaSTC22HanXRQChr13g0390011
Entry ID 14597
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC22HanXRQChr13g0390011
Name HaSTC22HanXRQChr13g0390011
Class Stellacyanin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC22
start..stop
S start..stop
HaSTC21 216 1e-70 1..126 1..126
HaSTC16 209 9e-70 1..124 1..124
HaSTC15 175 8e-57 18..124 16..122
HaCRX04 105 1e-29 6..136 1..134
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20691127..20691310 184 N° 2 20690685..20691052 368  
complement(join(20690685..20691052,20691127..20691310))


exon

Literature and cross-references HaSTC22HanXRQChr13g0390011
DNA ref. HanXRQ genome:   HanXRQChr13 (20691310..20690685)
Protein sequence: HaSTC22HanXRQChr13g0390011
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 183 (154)
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
18407.53 (15238.8)  
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
6.93 (5.10) Peptide Signal: %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 30 range:30-183
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNCTKMANKNLSIIILIATLVAQATWVRAAEHIVGDDKGWAEGVDYDAWAKGREFKPGDKLVFNYDPAKYSVLYVNICNYKCCCAEGPIMHVQDVAVLGGGGDYTFISDRDKCLKGMKLLVPVKPSGECPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPCPAKP

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTGTACCAAAATGGCTAACAAAAATTTGAGCATCATCATCCTCATAGCAACACTAGTGGCTCAAGCTACTTGGGTTAGAGCAGCAGAGCATATAGTTGGAGATGATAAAGGTTGG
GCCGAGGGTGTCGATTACGATGCATGGGCTAAGGGTCGGGAATTCAAGCCGGGAGACAAACTTG
GTAAATATTACACATGCTTTGTTGATAATTATATGTCTATGTCTTGCAGCAAGCTA
ACTATGTTGTTGGTTTAGTGTTCAATTACGATCCGGCAAAATATAGTGTATTATACGTCAATATTTGCAACTACAAGTGCTGTTGTGCTGAGGGACCAATTATGCATGTACAGGATGTGG
CCGTCTTAGGAGGAGGGGGCGACTATACGTTTATTTCTGATCGAGATAAGTGTTTGAAAGGTATGAAGCTTCTTGTCCCTGTCAAGCCATCTGGAGAGTGTCCCGGTGGGTGTCCTGGTG
GATGTCCCGGTGGGTGTCCCGGAGGATGTCCCGGAGGATGTCCGGGTGGGTGTCCCGGAGGGTGTCCGGGTGGGTGTCCCGGTGGGTGTCCCGGAGGGTGTCCCGGTGGGTGTCCCGGAG
GGTGTCCATGTCCTGCAAAGCCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTGTACCAAAATGGCTAACAAAAATTTGAGCATCATCATCCTCATAGCAACACTAGTGGCTCAAGCTACTTGGGTTAGAGCAGCAGAGCATATAGTTGGAGATGATAAAGGTTGG
GCCGAGGGTGTCGATTACGATGCATGGGCTAAGGGTCGGGAATTCAAGCCGGGAGACAAACTTG
TGTTCAATTACGATCCGGCAAAATATAGTGTATTATACGTCAATATTTGCAACTAC
AAGTGCTGTTGTGCTGAGGGACCAATTATGCATGTACAGGATGTGGCCGTCTTAGGAGGAGGGGGCGACTATACGTTTATTTCTGATCGAGATAAGTGTTTGAAAGGTATGAAGCTTCTT
GTCCCTGTCAAGCCATCTGGAGAGTGTCCCGGTGGGTGTCCTGGTGGATGTCCCGGTGGGTGTCCCGGAGGATGTCCCGGAGGATGTCCGGGTGGGTGTCCCGGAGGGTGTCCGGGTGGG
TGTCCCGGTGGGTGTCCCGGAGGGTGTCCCGGTGGGTGTCCCGGAGGGTGTCCATGTCCTGCAAAGCCATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTGTA CCAAAATGGC TAACAAAAAT TTGAGCATCA TCATCCTCAT AGCAACACTA GTGGCTCAAG CTACTTGGGT TAGAGCAGCA GAGCATATAG TTGGAGATGA TAAAGGTTGG  GCCGAGGGTG TCGATTACGA TGCATGGGCT AAGGGTCGGG AATTCAAGCC GGGAGACAAA CTTGTGTTCA ATTACGATCC GGCAAAATAT AGTGTATTAT ACGTCAATAT TTGCAACTAC  AAGTGCTGTT GTGCTGAGGG ACCAATTATG CATGTACAGG ATGTGGCCGT CTTAGGAGGA GGGGGCGACT ATACGTTTAT TTCTGATCGA GATAAGTGTT TGAAAGGTAT GAAGCTTCTT  GTCCCTGTCA AGCCATCTGG AGAGTGTCCC GGTGGGTGTC CTGGTGGATG TCCCGGTGGG TGTCCCGGAG GATGTCCCGG AGGATGTCCG GGTGGGTGTC CCGGAGGGTG TCCGGGTGGG  TGTCCCGGTG GGTGTCCCGG AGGGTGTCCC GGTGGGTGTC CCGGAGGGTG TCCATGTCCT GCAAAGCCAT AATGTCCTGC AAAGCCATCA TGTCCTCCAT GATACAAGCA CAAAACTCTA 
AGCTTTGAAG ATGGCATGTC TTGTTTCTTT TTTTATTTGT TGTTTGTTAA TAAATGTTAA TATCTGATCA ATAATTATAT 

Retrieve as FASTA