Entry information : HaSTC24HanXRQChr13g0398851
Entry ID 14599
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC24HanXRQChr13g0398851
Name HaSTC24HanXRQChr13g0398851
Class Stellacyanin    [Orthogroup: STC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC24
start..stop
S start..stop
HaSTC23 157 7e-51 1..125 1..125
HaSTC33 132 1e-39 5..124 4..122
HaSTC33 129 1e-38 28..124 145..240
HaSTC35 132 1e-39 5..124 4..122
HaSTC35 129 2e-38 28..124 147..242
HaSTC32 132 1e-39 5..124 4..122
HaSTC32 128 4e-38 28..124 147..242
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 80718077..80718248 172 N° 2 80717778..80717986 209  
complement(join(80717778..80717986,80718077..80718248))


exon

Literature and cross-references HaSTC24HanXRQChr13g0398851
DNA ref. HanXRQ genome:   HanXRQChr13 (80718248..80717778)
Protein sequence: HaSTC24HanXRQChr13g0398851
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   126 (101)
PWM (Da):   %s   13641.94 (10932.4) Transmb domain:   %s   i7-29o94-116i
PI (pH):   %s   6.49 (6.22) Peptide Signal:   %s   cut: 26 range:26-126
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFLNHIMVVLTLFVVAILPTTTIATEYTVGDDSGWTVQYDYQAWAKNKDFKVGDTLVFNYPKGIHNVFKVNGSSYADCIIPPPDQAYTSGHDVIALPVAGKAWFICGVGVHCSALNQKLAINVKV

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCTTGAACCATATTATGGTTGTTTTAACCCTTTTTGTTGTCGCGATACTTCCGACCACCACCATAGCAACGGAGTATACAGTCGGAGATGACAGTGGTTGGACCGTTCAATAT
GATTATCAAGCTTGGGCCAAAAATAAAGATTTTAAAGTTGGTGACACGTTAG
GTAAAAAAATCAGTATGTATATGATTTTGTATTAAACGCGCCCTTTATGTTATTTTGTGAATCAACTT
TAACGTTATTTTAACAATACAGTGTTTAATTATCCGAAAGGGATACATAACGTGTTCAAAGTGAATGGAAGTTCGTATGCTGATTGCATTATTCCACCGCCAGATCAAGCTTACACCTCT
GGGCACGACGTTATAGCACTCCCGGTCGCAGGCAAAGCGTGGTTTATTTGTGGTGTGGGAGTACATTGTTCTGCATTGAACCAAAAGCTAGCCATAAATGTTAAAGTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCTTGAACCATATTATGGTTGTTTTAACCCTTTTTGTTGTCGCGATACTTCCGACCACCACCATAGCAACGGAGTATACAGTCGGAGATGACAGTGGTTGGACCGTTCAATAT
GATTATCAAGCTTGGGCCAAAAATAAAGATTTTAAAGTTGGTGACACGTTAG
TGTTTAATTATCCGAAAGGGATACATAACGTGTTCAAAGTGAATGGAAGTTCGTATGCTGATTGCATT
ATTCCACCGCCAGATCAAGCTTACACCTCTGGGCACGACGTTATAGCACTCCCGGTCGCAGGCAAAGCGTGGTTTATTTGTGGTGTGGGAGTACATTGTTCTGCATTGAACCAAAAGCTA
GCCATAAATGTTAAAGTGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCT TGAACCATAT TATGGTTGTT TTAACCCTTT TTGTTGTCGC GATACTTCCG ACCACCACCA TAGCAACGGA GTATACAGTC GGAGATGACA GTGGTTGGAC CGTTCAATAT  GATTATCAAG CTTGGGCCAA AAATAAAGAT TTTAAAGTTG GTGACACGTT AGTGTTTAAT TATCCGAAAG GGATACATAA CGTGTTCAAA GTGAATGGAA GTTCGTATGC TGATTGCATT  ATTCCACCGC CAGATCAAGC TTACACCTCT GGGCACGACG TTATAGCACT CCCGGTCGCA GGCAAAGCGT GGTTTATTTG TGGTGTGGGA GTACATTGTT CTGCATTGAA CCAAAAGCTA 
GCCATAAATG TTAAAGTGTG A 

Retrieve as FASTA