Entry information : HaSTC28HanXRQChr13g0417181
Entry ID 14603
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC28HanXRQChr13g0417181
Name HaSTC28HanXRQChr13g0417181
Class Stellacyanin    [Orthogroup: STC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC28
start..stop
S start..stop
HaSTC31 314 7e-107 2..246 1..243
HaSTC31 299 6e-101 145..365 23..243
HaSTC32 311 6e-106 2..246 1..243
HaSTC32 298 1e-100 145..365 23..243
HaSTC35 311 7e-106 2..246 1..243
HaSTC35 295 3e-99 145..365 23..243
HaSTC34 310 2e-105 2..246 1..243
HaSTC34 295 1e-99 145..365 23..243
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 163430814..163430985 172 N° 2 163430251..163430613 363 N° 3 163429717..163430073 357 N° 4 163429330..163429625 296
complement(join(163429330..163429625,163429717..163430073,163430251..163430613,1 63430814..163430985))


exon

Literature and cross-references HaSTC28HanXRQChr13g0417181
DNA ref. HanXRQ genome:   HanXRQChr13 (163430985..163429330)
Protein sequence: HaSTC28HanXRQChr13g0417181
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   395 (370)
PWM (Da):   %s   42759.87 (40188.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.95 (8.83) Peptide Signal:   %s   cut: 26 range:26-395
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVTNNKLAIVIFIGLIATLAAFVSATDFIVGDEYGWTLNFDYQAWAQGKKFVVGDKLVFKYPVGKHNVFKVDGNGFKGCVVPVANESLASGYDVVTLTTPGKKWYICGVGKHCETGGMKLVIDVLAWSPVLPFPVPAPAPGPVPSGKVFVVGDDYGWTLNFDYQAWAKGKEFVVGDKLVFKYPVGKHNVFKVDGNGFKGCVVPASNESLTSGYDVITLTTPGKKWYICGVGTHCETGGMKLVIDVLSWSPVQPVPAPAPGPVPLGNMFIVGDDYGWTLDFDYQAWAKGKEFVVGDKLVFIYPKGAHNVYKVNGTDFQQCTIPVSGEPLSSGYDWVTLTTPGRKWYICGVGKHCQKGGMKLVIDVLPRSTYPPSPSPWGSYKARRMGNTRVLGRVA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGACTAACAACAAGTTAGCCATCGTTATATTCATAGGTCTGATAGCAACTCTAGCTGCTTTTGTTTCGGCTACCGACTTCATTGTTGGAGACGAGTATGGCTGGACTCTCAACTTC
GACTACCAAGCATGGGCCCAAGGGAAGAAGTTCGTCGTCGGAGACAAACTTG
GTATGTGAAATCATTTATTTCAAACTAGTAAGGATGATCTATGAACAAATTACGTCAAACATAATCAT
CGTCGATACGTTCTACCAAACGTTACATAAAAACACATTTTAGGATAGAGAGAGTATGATTTGTTTGAATAATGACCGAATCATGCATGTCCCTCATTAATAATAAGAACTAATGATGTT
TTCTTCTTTTAGTATTCAAGTACCCGGTTGGAAAACACAATGTGTTCAAAGTCGATGGAAATGGTTTTAAAGGATGTGTCGTGCCAGTTGCTAACGAGTCTTTGGCAAGTGGATATGATG
TGGTAACACTTACTACGCCAGGAAAGAAATGGTACATTTGTGGTGTTGGAAAACATTGCGAGACGGGTGGGATGAAGTTGGTTATTGATGTTTTGGCTTGGTCACCCGTACTACCGTTCC
CGGTACCTGCACCCGCACCCGGCCCCGTGCCGTCTGGAAAGGTGTTTGTCGTCGGAGATGACTATGGCTGGACCCTCAACTTCGATTACCAAGCTTGGGCCAAAGGGAAGGAGTTCGTCG
TCGGAGACAAGCTTG
GTATGTAAATCATTTATTTCTAAATAGTAATGGTGATCTATGAACAACTTATGTCAAACATGATCATCGTTGATACGTTTGATCAAACGATTAAATACAAGTACG
TTTTAGGAGAATATATACATATATGTGTCTTATAAATAAGAACTAATGAGTAATGATGTTTTTTGGGTGTAGTATTCAAGTACCCGGTCGGGAAACACAATGTGTTCAAGGTCGATGGAA
ACGGTTTTAAAGGATGTGTTGTGCCAGCTTCCAACGAGTCTTTGACAAGTGGATATGATGTGATAACACTTACTACGCCCGGAAAGAAATGGTACATTTGTGGTGTTGGAACACATTGTG
AGACAGGTGGAATGAAGTTGGTTATTGATGTTTTGTCCTGGTCACCAGTACAACCTGTACCCGCACCTGCACCCGGCCCAGTACCGCTTGGAAACATGTTCATCGTCGGAGATGACTATG
GCTGGACTCTCGACTTCGATTACCAAGCCTGGGCCAAAGGGAAGGAATTCGTAGTCGGAGACAAGCTTG
GTATATCATTAATCTTTTTTTTAAAGACACATCAACTCTTAGGTTTTTTTG
GCTTGGCTACTTTGTTTCTAACAAAATGATTTCGATGTAGTTTTTATATACCCGAAGGGGGCTCATAACGTATACAAAGTCAACGGAACTGACTTCCAACAATGTACTATTCCGGTTTCT
GGTGAACCTCTATCTAGTGGTTATGATTGGGTGACATTGACGACCCCTGGAAGAAAATGGTACATTTGTGGTGTTGGAAAGCATTGTCAAAAGGGCGGTATGAAGCTTGTTATTGACGTT
CTTCCTCGATCAACATATCCGCCTTCCCCAAGTCCATGGGGTTCATACAAAGCTAGACGTATGGGAAACACACGAGTTCTTGGACGTGTGGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGACTAACAACAAGTTAGCCATCGTTATATTCATAGGTCTGATAGCAACTCTAGCTGCTTTTGTTTCGGCTACCGACTTCATTGTTGGAGACGAGTATGGCTGGACTCTCAACTTC
GACTACCAAGCATGGGCCCAAGGGAAGAAGTTCGTCGTCGGAGACAAACTTG
TATTCAAGTACCCGGTTGGAAAACACAATGTGTTCAAAGTCGATGGAAATGGTTTTAAAGGATGTGTC
GTGCCAGTTGCTAACGAGTCTTTGGCAAGTGGATATGATGTGGTAACACTTACTACGCCAGGAAAGAAATGGTACATTTGTGGTGTTGGAAAACATTGCGAGACGGGTGGGATGAAGTTG
GTTATTGATGTTTTGGCTTGGTCACCCGTACTACCGTTCCCGGTACCTGCACCCGCACCCGGCCCCGTGCCGTCTGGAAAGGTGTTTGTCGTCGGAGATGACTATGGCTGGACCCTCAAC
TTCGATTACCAAGCTTGGGCCAAAGGGAAGGAGTTCGTCGTCGGAGACAAGCTTG
TATTCAAGTACCCGGTCGGGAAACACAATGTGTTCAAGGTCGATGGAAACGGTTTTAAAGGATGT
GTTGTGCCAGCTTCCAACGAGTCTTTGACAAGTGGATATGATGTGATAACACTTACTACGCCCGGAAAGAAATGGTACATTTGTGGTGTTGGAACACATTGTGAGACAGGTGGAATGAAG
TTGGTTATTGATGTTTTGTCCTGGTCACCAGTACAACCTGTACCCGCACCTGCACCCGGCCCAGTACCGCTTGGAAACATGTTCATCGTCGGAGATGACTATGGCTGGACTCTCGACTTC
GATTACCAAGCCTGGGCCAAAGGGAAGGAATTCGTAGTCGGAGACAAGCTTG
TTTTTATATACCCGAAGGGGGCTCATAACGTATACAAAGTCAACGGAACTGACTTCCAACAATGTACT
ATTCCGGTTTCTGGTGAACCTCTATCTAGTGGTTATGATTGGGTGACATTGACGACCCCTGGAAGAAAATGGTACATTTGTGGTGTTGGAAAGCATTGTCAAAAGGGCGGTATGAAGCTT
GTTATTGACGTTCTTCCTCGATCAACATATCCGCCTTCCCCAAGTCCATGGGGTTCATACAAAGCTAGACGTATGGGAAACACACGAGTTCTTGGACGTGTGGCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGACTA ACAACAAGTT AGCCATCGTT ATATTCATAG GTCTGATAGC AACTCTAGCT GCTTTTGTTT CGGCTACCGA CTTCATTGTT GGAGACGAGT ATGGCTGGAC TCTCAACTTC  GACTACCAAG CATGGGCCCA AGGGAAGAAG TTCGTCGTCG GAGACAAACT TGTATTCAAG TACCCGGTTG GAAAACACAA TGTGTTCAAA GTCGATGGAA ATGGTTTTAA AGGATGTGTC  GTGCCAGTTG CTAACGAGTC TTTGGCAAGT GGATATGATG TGGTAACACT TACTACGCCA GGAAAGAAAT GGTACATTTG TGGTGTTGGA AAACATTGCG AGACGGGTGG GATGAAGTTG  GTTATTGATG TTTTGGCTTG GTCACCCGTA CTACCGTTCC CGGTACCTGC ACCCGCACCC GGCCCCGTGC CGTCTGGAAA GGTGTTTGTC GTCGGAGATG ACTATGGCTG GACCCTCAAC  TTCGATTACC AAGCTTGGGC CAAAGGGAAG GAGTTCGTCG TCGGAGACAA GCTTGTATTC AAGTACCCGG TCGGGAAACA CAATGTGTTC AAGGTCGATG GAAACGGTTT TAAAGGATGT  GTTGTGCCAG CTTCCAACGA GTCTTTGACA AGTGGATATG ATGTGATAAC ACTTACTACG CCCGGAAAGA AATGGTACAT TTGTGGTGTT GGAACACATT GTGAGACAGG TGGAATGAAG  TTGGTTATTG ATGTTTTGTC CTGGTCACCA GTACAACCTG TACCCGCACC TGCACCCGGC CCAGTACCGC TTGGAAACAT GTTCATCGTC GGAGATGACT ATGGCTGGAC TCTCGACTTC  GATTACCAAG CCTGGGCCAA AGGGAAGGAA TTCGTAGTCG GAGACAAGCT TGTTTTTATA TACCCGAAGG GGGCTCATAA CGTATACAAA GTCAACGGAA CTGACTTCCA ACAATGTACT  ATTCCGGTTT CTGGTGAACC TCTATCTAGT GGTTATGATT GGGTGACATT GACGACCCCT GGAAGAAAAT GGTACATTTG TGGTGTTGGA AAGCATTGTC AAAAGGGCGG TATGAAGCTT 
GTTATTGACG TTCTTCCTCG ATCAACATAT CCGCCTTCCC CAAGTCCATG GGGTTCATAC AAAGCTAGAC GTATGGGAAA CACACGAGTT CTTGGACGTG TGGCTTGA 

Retrieve as FASTA