Entry information : HaSTC32HanXRQChr17g0561401
Entry ID 14607
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC32HanXRQChr17g0561401
Name HaSTC32HanXRQChr17g0561401
Class Stellacyanin    [Orthogroup: STC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC32
start..stop
S start..stop
HaSTC34 535 0 1..263 1..263
HaSTC35 533 0 1..263 1..263
HaSTC31 529 0 1..263 1..263
HaSTC33 462 2e-167 1..263 1..261
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 158865427..158865595 169 N° 2 158865698..158866057 360 N° 3 158866143..158866405 263  
join(158865427..158865595,158865698..158866057,158866143..158866405)


exon

Literature and cross-references HaSTC32HanXRQChr17g0561401
DNA ref. HanXRQ genome:   HanXRQChr17 (158865427..158866405)
Protein sequence: HaSTC32HanXRQChr17g0561401
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   263 (239)
PWM (Da):   %s   29007.95 (26633.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.44 (9.33) Peptide Signal:   %s   cut: 25 range:25-263
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATNKWGVIFVAATIAALATSVSAKLFTVGDEKGWTLNFDYQAWAKDKVFVVGDQLVFKYATGKHNVFRVNGTVFQQCIIPPTNEALTSGYDVITLATPGRKWYICGVGKHCEYGLKLFINVLPQSYPSPPPPPPPSVYPAPSGKVFVVGDDKGWTLDFDYQAWAMGKKFYVGDKLVFRYPKGIHNVFRVDGTSFQQCIIPAAYEALTSGYDVITLQTPGRKWYICGVGKHCQTGLKLFINVLPYPTYVPPPYHGTRKLAPPS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTAACAAGTGGGGCGTCATCTTTGTCGCAGCAACAATAGCAGCTTTAGCTACTTCAGTTTCGGCCAAGTTGTTTACTGTTGGTGACGAGAAAGGTTGGACACTCAACTTCGAT
TATCAAGCTTGGGCCAAAGACAAGGTATTCGTTGTTGGAGATCAACTCG
GTATGTGTCCTTTTACAATATGAGCATTATGTACTTCTGTACGATGGGTACTCGTGTTAGTAGGTGTTTAT
ATAATAAATTCTGTATGCGTTATGTGTGTAGTTTTCAAATACGCTACTGGAAAACACAATGTCTTCAGAGTCAACGGAACTGTTTTCCAACAGTGCATCATTCCTCCTACAAATGAAGCT
CTTACTAGTGGATATGACGTGATAACACTAGCAACTCCAGGAAGAAAATGGTACATATGTGGAGTTGGCAAGCACTGTGAGTATGGTTTGAAGCTTTTCATCAACGTGCTTCCACAATCA
TATCCTTCACCTCCCCCTCCACCTCCTCCATCGGTTTATCCAGCTCCTTCAGGCAAAGTGTTTGTGGTTGGAGATGATAAAGGCTGGACCCTGGACTTTGATTACCAAGCTTGGGCCATG
GGAAAGAAATTCTATGTCGGAGATAAGCTTG
GTGCGTATTTATACGCCATCCAATATTTGTGTGAATCGAATGTTTTGATGCAGATTGCTAACTGGTTACAACTTTATTGTCACAGTTTT
CAGGTACCCAAAGGGAATACATAATGTATTTAGAGTAGATGGAACTTCATTCCAGCAATGTATCATTCCTGCTGCTTATGAAGCCCTCACCAGTGGATACGACGTGATCACTTTACAAAC
CCCGGGGAGGAAATGGTACATTTGTGGTGTTGGAAAACACTGCCAGACGGGGTTGAAGCTTTTCATCAATGTACTTCCCTATCCAACATATGTACCGCCTCCATACCATGGAACAAGAAA
ACTCGCACCACCTAGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTAACAAGTGGGGCGTCATCTTTGTCGCAGCAACAATAGCAGCTTTAGCTACTTCAGTTTCGGCCAAGTTGTTTACTGTTGGTGACGAGAAAGGTTGGACACTCAACTTCGAT
TATCAAGCTTGGGCCAAAGACAAGGTATTCGTTGTTGGAGATCAACTCG
TTTTCAAATACGCTACTGGAAAACACAATGTCTTCAGAGTCAACGGAACTGTTTTCCAACAGTGCATCATT
CCTCCTACAAATGAAGCTCTTACTAGTGGATATGACGTGATAACACTAGCAACTCCAGGAAGAAAATGGTACATATGTGGAGTTGGCAAGCACTGTGAGTATGGTTTGAAGCTTTTCATC
AACGTGCTTCCACAATCATATCCTTCACCTCCCCCTCCACCTCCTCCATCGGTTTATCCAGCTCCTTCAGGCAAAGTGTTTGTGGTTGGAGATGATAAAGGCTGGACCCTGGACTTTGAT
TACCAAGCTTGGGCCATGGGAAAGAAATTCTATGTCGGAGATAAGCTTG
TTTTCAGGTACCCAAAGGGAATACATAATGTATTTAGAGTAGATGGAACTTCATTCCAGCAATGTATCATT
CCTGCTGCTTATGAAGCCCTCACCAGTGGATACGACGTGATCACTTTACAAACCCCGGGGAGGAAATGGTACATTTGTGGTGTTGGAAAACACTGCCAGACGGGGTTGAAGCTTTTCATC
AATGTACTTCCCTATCCAACATATGTACCGCCTCCATACCATGGAACAAGAAAACTCGCACCACCTAGTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTA ACAAGTGGGG CGTCATCTTT GTCGCAGCAA CAATAGCAGC TTTAGCTACT TCAGTTTCGG CCAAGTTGTT TACTGTTGGT GACGAGAAAG GTTGGACACT CAACTTCGAT  TATCAAGCTT GGGCCAAAGA CAAGGTATTC GTTGTTGGAG ATCAACTCGT TTTCAAATAC GCTACTGGAA AACACAATGT CTTCAGAGTC AACGGAACTG TTTTCCAACA GTGCATCATT  CCTCCTACAA ATGAAGCTCT TACTAGTGGA TATGACGTGA TAACACTAGC AACTCCAGGA AGAAAATGGT ACATATGTGG AGTTGGCAAG CACTGTGAGT ATGGTTTGAA GCTTTTCATC  AACGTGCTTC CACAATCATA TCCTTCACCT CCCCCTCCAC CTCCTCCATC GGTTTATCCA GCTCCTTCAG GCAAAGTGTT TGTGGTTGGA GATGATAAAG GCTGGACCCT GGACTTTGAT  TACCAAGCTT GGGCCATGGG AAAGAAATTC TATGTCGGAG ATAAGCTTGT TTTCAGGTAC CCAAAGGGAA TACATAATGT ATTTAGAGTA GATGGAACTT CATTCCAGCA ATGTATCATT  CCTGCTGCTT ATGAAGCCCT CACCAGTGGA TACGACGTGA TCACTTTACA AACCCCGGGG AGGAAATGGT ACATTTGTGG TGTTGGAAAA CACTGCCAGA CGGGGTTGAA GCTTTTCATC 
AATGTACTTC CCTATCCAAC ATATGTACCG CCTCCATACC ATGGAACAAG AAAACTCGCA CCACCTAGTT AA 

Retrieve as FASTA