Entry information : HaPrx02 (HanXRQChr05g0151231)
Entry ID 1470
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2016-04-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx02 (HanXRQChr05g0151231)
Name (synonym) HaPrx02 (HanXRQChr05g0151231)
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx02
start..stop
S start..stop
LsaPrx30 589 0 1..356 1..357
HaPrx30 527 0 1..356 26..387
VvPrx89 504 0 1..356 1..352
TsPrx09 500 2e-179 1..356 1..352
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 169564978..169565277 300 N° 2 169565350..169565541 192 N° 3 169565627..169565792 166 N° 4 169565907..169566319 413
join(169564978..169565277,169565350..169565541,169565627..169565792,169565907..1 69566319)


exon

Literature and cross-references HaPrx02 (HanXRQChr05g0151231)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L., Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison ,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project Unpublished (2002). Genoplante
DNA ref. HanXRQ genome:   HanXRQChr05 (169564978..169566319)
Protein sequence: HaPrx02 (HanXRQChr05g0151231)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   356 (331)
PWM (Da):   %s   38822.91 (36085.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   10.21 (10.28) Peptide Signal:   %s   cut: 26 range:26-356
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASFKLLYVTFTLLTLLSSSTFCLGYPGFNFGRGRGGRGVGGVSRPIGGQRFSGLSPRFYSQSCPQANDIVISVLKTAISKDPRMAASLIRLHFHDCFVQGCDASVLLDDHPTFTSEKKSVPNKNSIRGFEVIDEIKAKLEQACPQTVSCADILALAARGSTVLSGGPNWELPLGRRDSRKASLNGSNKNIPPPNSTIQNLVTSFRRQGLNEVDLVSLSGAHTLGMARCTTFKQRLYNQNGNNQPDSTLERSYYHDLKGVCPKTGGDNNISPLDLASPITFDNMYFKLIMSGKGLLTSDQVLLSGKLGKTMQLVKAFADDHTLFFNHFARSMVRMGNIRLVTGNKGEVRKNCRRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 2 EST (mRNA mix). 3' end is missing
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTTCAAACTTCTCTATGTCACTTTCACACTACTTACTCTACTCTCATCCTCCACTTTCTGCTTAGGCTACCCTGGCTTCAACTTTGGGCGGGGTCGCGGTGGTCGTGGCGTC
GGTGGTGTTAGCCGCCCTATTGGCGGTCAAAGGTTTTCTGGACTCTCCCCGCGATTTTACAGTCAGTCTTGCCCTCAAGCTAACGACATTGTCATATCGGTCCTTAAAACCGCAATCTCT
AAGGACCCGAGAATGGCTGCTTCTTTGATCAGGCTTCATTTTCATGACTGTTTTGTTCAG
GTTAATTAGTTTTTATTACTTTTTAAATATGTTTTATCGTGATAGACGCTGTAAAGTTTT
ATGATCTTTCAGGGATGTGATGCATCTGTGCTGTTGGATGATCATCCAACATTTACTAGCGAAAAGAAATCGGTCCCAAACAAGAATTCTATTCGCGGGTTTGAAGTGATTGATGAGATC
AAAGCTAAACTCGAACAAGCTTGTCCCCAGACAGTTTCTTGTGCGGACATTCTTGCCCTTGCCGCTCGAGGCTCCACTGTTCTA
GTAAGCACTAGAAACATATTTTTATTGACTATAATA
CCCTTTTCGTTTCAAGAATTAACTAACTTAACTGTCAAAAATATACCAGAGTGGTGGACCGAATTGGGAATTACCATTAGGTAGACGCGACTCGAGAAAAGCCAGTCTTAACGGATCAAA
CAAAAACATTCCTCCACCGAATTCAACGATTCAAAATCTTGTAACATCTTTTCGACGTCAAGGCCTTAACGAAGTTGATCTAGTCTCACTTTCTG
GTTAGTTATTTTATGAAAATAACGC
CTTAACATGCTTTCTTTTTATATAGTGCGATTAGTGCGTATAAAAACTATGTTTTTTATATGAATTTCTTTTTTTGAATTTTATTGCAGGAGCTCATACATTAGGGATGGCGAGATGCAC
GACGTTTAAGCAACGACTATACAATCAAAACGGAAACAACCAACCCGATTCAACTCTAGAAAGAAGCTACTACCATGACTTGAAAGGCGTATGCCCTAAAACCGGCGGTGACAACAACAT
TTCACCGCTAGATCTTGCATCACCCATAACATTCGACAACATGTATTTCAAGCTCATCATGTCTGGAAAAGGTCTTCTTACTTCAGACCAAGTGCTTTTGTCTGGAAAACTTGGAAAAAC
TATGCAGTTAGTGAAGGCTTTTGCTGATGATCACACTCTTTTCTTTAACCATTTCGCGCGATCCATGGTTAGAATGGGTAATATCCGTCTGGTTACCGGTAACAAGGGTGAAGTAAGGAA
GAACTGCAGAAGGATTAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTTCAAACTTCTCTATGTCACTTTCACACTACTTACTCTACTCTCATCCTCCACTTTCTGCTTAGGCTACCCTGGCTTCAACTTTGGGCGGGGTCGCGGTGGTCGTGGCGTC
GGTGGTGTTAGCCGCCCTATTGGCGGTCAAAGGTTTTCTGGACTCTCCCCGCGATTTTACAGTCAGTCTTGCCCTCAAGCTAACGACATTGTCATATCGGTCCTTAAAACCGCAATCTCT
AAGGACCCGAGAATGGCTGCTTCTTTGATCAGGCTTCATTTTCATGACTGTTTTGTTCAG
GGATGTGATGCATCTGTGCTGTTGGATGATCATCCAACATTTACTAGCGAAAAGAAATCG
GTCCCAAACAAGAATTCTATTCGCGGGTTTGAAGTGATTGATGAGATCAAAGCTAAACTCGAACAAGCTTGTCCCCAGACAGTTTCTTGTGCGGACATTCTTGCCCTTGCCGCTCGAGGC
TCCACTGTTCTA
AGTGGTGGACCGAATTGGGAATTACCATTAGGTAGACGCGACTCGAGAAAAGCCAGTCTTAACGGATCAAACAAAAACATTCCTCCACCGAATTCAACGATTCAAAAT
CTTGTAACATCTTTTCGACGTCAAGGCCTTAACGAAGTTGATCTAGTCTCACTTTCTG
GAGCTCATACATTAGGGATGGCGAGATGCACGACGTTTAAGCAACGACTATACAATCAAAAC
GGAAACAACCAACCCGATTCAACTCTAGAAAGAAGCTACTACCATGACTTGAAAGGCGTATGCCCTAAAACCGGCGGTGACAACAACATTTCACCGCTAGATCTTGCATCACCCATAACA
TTCGACAACATGTATTTCAAGCTCATCATGTCTGGAAAAGGTCTTCTTACTTCAGACCAAGTGCTTTTGTCTGGAAAACTTGGAAAAACTATGCAGTTAGTGAAGGCTTTTGCTGATGAT
CACACTCTTTTCTTTAACCATTTCGCGCGATCCATGGTTAGAATGGGTAATATCCGTCTGGTTACCGGTAACAAGGGTGAAGTAAGGAAGAACTGCAGAAGGATTAATTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCCACC TCTATATATA CCTCCCCACT TTCATGCAAT CAAATCACAC AAACCTAAAC CTCAATGGCT TCTTTCAAAC TTCTCTATGT CACTTTCACA CTACTTACTC TACTCTCATC  CTCCACTTTC TGCTTAGGCT ACCCTGGCTT CAACTTTGGG CGGGGTCGCG GTGGTCGTGG CGTCGGTGGT GTTAGCCGCC CTATTGGCGG TCAAAGGTTT TCTGGACTCT CCCCGCGATT  TTACAGTCAG TCTTGCCCTC AAGCTAACGA CATTGTCATA TCGGTCCTTA AAACCGCAAT CTCTAAGGAC CCGAGAATGG CTGCTTCTTT GATCAGGCTT CATTTTCATG ACTGTTTTGT  TCAGGGATGT GATGCATCTG TGCTGTTGGA TGATCATCCA ACATTTACTA GCGAAAAGAA ATCGGTCCCA AACAAGAATT CTATTCGCGG GTTTGAAGTG ATTGATGAGA TCAAAGCTAA  ACTCGAACAA GCTTGTCCCC AGACAGTTTC TTGTGCGGAC ATTCTTGCCC TTGCCGCTCG AGGCTCCACT GTTCTAAGTG GTGGACCGAA TTGGGAATTA CCATTAGGTA GACGCGACTC  GAGAAAAGCC AGTCTTAACG GATCAAACAA AAACATTCCT CCACCGAATT CAACGATTCA AAATCTTGTA ACATCTTTTC GACGTCAAGG CCTTAACGAA GTTGATCTAG TCTCACTTTC  TGGAGCTCAT ACATTAGGGA TGGCGAGATG CACGACGTTT AAGCAACGAC TATACAATCA AAACGGAAAC AACCAACCCG ATTCAACTCT AGAAAGAAGC TACTACCATG ACTTGAAAGG  CGTATGCCCT AAAACCGGCG GTGACAACAA CATTTCACCG CTAGATCTTG CATCACCCAT AACATTCGAC AACATGTATT TCAAGCTCAT CATGTCTGGA AAAGGTCTTC TTACTTCAGA  CCAAGTGCTT TTGTCTGGAA AACTTGGAAA AACTATGCAG TTAGTGAAGG CTTTTGCTGA TGATCACACT CTTTTCTTTA ACCATTTCGC GCGATCCATG GTTAGAATGG GTAATATCCG  TCTGGTTACC GGTAACAAGG GTGAAGTAAG GAAGAACTGC AGAAGGATTA ATTAGTGTGA TATCTAGATC TTGTGTATGT TTATGTTTAT TATTAAGAAC CTAATGGGCT GTTATTGAAC 
TAGTATGTAA TCTGTTAACT TGTTGAAATA TGAATGATTT TATGATATAT CGAGTCAAAT CGGTTCATTA TGTGTAAAAT ATATATCAAG AATCGA 

Retrieve as FASTA