Entry information : HaPrx04 (HanXRQChr16g0531731)
Entry ID 1473
Creation 2005-07-12 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx04 (HanXRQChr16g0531731)
Name (synonym) HaPrx04 (HanXRQChr16g0531731)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx04
start..stop
S start..stop
LsPrx43 533 0 1..298 4..301
PpePrx30 496 6e-179 3..312 6..318
MePrx02 493 4e-178 4..312 8..316
GmPrx06 491 2e-177 1..312 4..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 182142417..182142611 195 N° 2 182142697..182142885 189 N° 3 182142963..182143125 163 N° 4 182144531..182144922 392
join(182142417..182142611,182142697..182142885,182142963..182143125,182144531..1 82144922)


exon

Literature and cross-references HaPrx04 (HanXRQChr16g0531731)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L., Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison ,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project Unpublished (2002). Genoplante
DNA ref. HanXRQ genome:   HanXRQChr16 (182142417..182144922)
Cluster/Prediction ref. HanXRQ:   HanXRQChr16g0531731
Protein sequence: HaPrx04 (HanXRQChr16g0531731)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   312 (293)
PWM (Da):   %s   33507.33 (31553.3)  
PI (pH):   %s   10.06 (10.06) Peptide Signal:   %s   cut: 20 range:20-312
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSALLASLLIFSLFTSATSLSSNYYAKTCPNVESLVRKAVRDAATSDKKVPAALLRMHFHDCFIRGCDASVLLDSKGKNKAEKDGPPNISLHAFYVIDNAKKAVESACPGIVSCADILALAARDSVVLSGGPSWDVPKGRKDGRTSLASETLQLPFPTFNISQLQKSFAQRGLSLDDLVALSGGHTLGFSHCSSFKSRIHNFNSVTDVDPSLNPSFAASLKKICPVKNAKNAGVPMDPSSTSFDNKYYKLIFQKKVLFSSDKALLDLPKTRNLAAKFAGSKYAFTNAFVNSMIKMSSITGGQEVRKNCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCATTGTTAGCCTCACTACTCATTTTCTCGTTGTTCACTTCCGCAACTTCACTAAGCTCAAACTACTATGCGAAAACATGCCCTAATGTCGAATCACTCGTCAGAAAAGCAGTG
AGGGACGCAGCGACAAGTGACAAGAAAGTCCCTGCGGCGTTGCTAAGGATGCACTTCCATGACTGTTTCATAAGG
GTAAAAAAAAATTATTTATTTTATGTTTTAAGTTGCATGATTTTG
TTTGTGTCGGTGACTTAATTCGGTTTGATATTTTTGGAAGGGGTGTGATGCTTCTGTTTTGCTGGATTCTAAGGGAAAAAACAAAGCTGAAAAGGACGGGCCACCAAATATTTCGTTGCA
TGCATTTTATGTCATCGATAATGCTAAGAAAGCAGTCGAATCTGCGTGCCCAGGAATAGTTTCGTGTGCTGATATCTTAGCTTTAGCGGCTAGGGATTCCGTCGTGCTG
GTAATAACAAA
AGTTATATTGTTTGAATATTAGTTTAGTAAATATAAAAATATCATGATTAATTGTGTTTTATACAGTCTGGAGGGCCATCATGGGATGTTCCTAAAGGAAGAAAAGATGGAAGAACATCA
TTAGCAAGTGAAACATTACAACTCCCCTTTCCTACCTTCAATATATCCCAACTTCAAAAAAGCTTTGCTCAAAGAGGTCTATCTCTAGATGACCTAGTGGCACTTTCAG
GTAACATCAGC
TGTCAAAACTTCCGGTGGTCATCGAACCGACCACCTTACAGGTTCATCGGTTGGACCAGATTTAAAAACCGGATGATATAACTAATTTTGAATAATAGTTATATAGGGGAAGGTTCAAAT
GAAAACCACTAGTTATTGTGAAAACTCGAAAACTAATTAAAAAAAGCCAAAAAAACATACAAAAAAAAAATTTTTTTAATTTTTTTTTTTTTGCAATCAAAATTTCGCAGGTTTTTTAAT
ATAAAAAAAAATTTCAAAAAAAAAATTTTTGTGTAGTGCACATGTGTAATACTGCACATATGTATGTGTACTACACATGTGTATTATTACACATGTGCACTACACAAAATTTTTTTTTTT
TTTTTTTTTTGAAAAAAAGTTTTTTTTATATATAAAAACTAGCGATTTTTATAAAAAAAAATTGAAAAAAAAAATTGTGTGTTTTTTATGCTTTTTTTAGTTAGTTTTCGAGTTTTCACA
ATAAAAGTGGTTTTCATTTGAACCATCCCCTAGTTATATATTACATTAAGTGTATATAGCATATTAAATTGAATTGAAAGTTTAATAAGAGCATTCACATCCAAATAACTAAATTATGTG
TGTGGTGTTTTTAAAATATAAAAAGTATAAAAAGTGGTTGTGAGTGGAGGAGAGAGAAAATGTTACTGTTCATCTGTATATTTGGGGGGACACTATTCACCCCCTATAATTTTTTAATAT
ATTTTGAAAGTGGTTGTGAGTGGAGGATAGAGAAAAGATAATGATAAATGTATAAAAATTATTATTTAATTGAAAAGGAGAGAGAAAATGTAGTGTTTTTTAGTGTAATTTAGGGTGAAA
ATATGGTGGATTGAATGTGAATGCTCTAAAAGAATGTTGTCGTGTTAGCTATATTTAAAAAATAAATAATTTATATATTGTTTTCTTCTTAAAAGATATAATAAAAGTTGTAATGAATAA
AAGAGATTAAATGTTTTTTGAGAGTATTCAGTTTATATATCTAATAATGCAACATCAATTTCTTCCTAGAAGAGTTGAAATTCCGCGAGCTATAAAATATTTTATTTTTTTTTATTTATT
TATTTATTTTTTTTTTTTTTATTTTTTTGCAAGAAGTAAAAAATTCAAAACTGGTCCAACCCTACCAAACTGGCCGGTCCGGTGTGGTCATGAAAACATAATAGAGGTGGTAAAATGTGC
GGGTGAAGTAGGTTGGGTAACAAATCACAATGGGTGATATTAGATACAAACGGGCCGGATTGGCCTGGAACGCTTTTGGTACAAACATATTTAATCTTTTATACAAATAACGAGTGTCAC
ATACAATAAGACATTATATTATTTAACTAATAATCTTTATACATAAAAATTTTGTGCATTTACCTTGTTTTCAGGTGGTCATACTCTTGGTTTCTCCCATTGCTCATCATTCAAAAGCCG
AATCCACAACTTCAACTCAGTAACTGATGTTGACCCGTCACTCAACCCTTCATTTGCCGCAAGTTTAAAGAAAATTTGTCCAGTCAAAAACGCAAAGAACGCAGGAGTTCCAATGGATCC
TTCTTCTACAAGTTTCGATAATAAATACTACAAACTTATTTTCCAAAAAAAAGTCTTATTTTCTTCGGATAAAGCTTTGCTTGATTTGCCGAAAACTAGAAATCTGGCAGCAAAGTTTGC
GGGTTCAAAATACGCATTCACAAATGCATTTGTAAACTCCATGATCAAGATGAGTAGCATTACAGGTGGTCAAGAGGTCAGAAAGAACTGTAGGGTCGTAAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCATTGTTAGCCTCACTACTCATTTTCTCGTTGTTCACTTCCGCAACTTCACTAAGCTCAAACTACTATGCGAAAACATGCCCTAATGTCGAATCACTCGTCAGAAAAGCAGTG
AGGGACGCAGCGACAAGTGACAAGAAAGTCCCTGCGGCGTTGCTAAGGATGCACTTCCATGACTGTTTCATAAGG
GGGTGTGATGCTTCTGTTTTGCTGGATTCTAAGGGAAAAAACAAA
GCTGAAAAGGACGGGCCACCAAATATTTCGTTGCATGCATTTTATGTCATCGATAATGCTAAGAAAGCAGTCGAATCTGCGTGCCCAGGAATAGTTTCGTGTGCTGATATCTTAGCTTTA
GCGGCTAGGGATTCCGTCGTGCTG
TCTGGAGGGCCATCATGGGATGTTCCTAAAGGAAGAAAAGATGGAAGAACATCATTAGCAAGTGAAACATTACAACTCCCCTTTCCTACCTTCAAT
ATATCCCAACTTCAAAAAAGCTTTGCTCAAAGAGGTCTATCTCTAGATGACCTAGTGGCACTTTCAG
GTGGTCATACTCTTGGTTTCTCCCATTGCTCATCATTCAAAAGCCGAATCCAC
AACTTCAACTCAGTAACTGATGTTGACCCGTCACTCAACCCTTCATTTGCCGCAAGTTTAAAGAAAATTTGTCCAGTCAAAAACGCAAAGAACGCAGGAGTTCCAATGGATCCTTCTTCT
ACAAGTTTCGATAATAAATACTACAAACTTATTTTCCAAAAAAAAGTCTTATTTTCTTCGGATAAAGCTTTGCTTGATTTGCCGAAAACTAGAAATCTGGCAGCAAAGTTTGCGGGTTCA
AAATACGCATTCACAAATGCATTTGTAAACTCCATGATCAAGATGAGTAGCATTACAGGTGGTCAAGAGGTCAGAAAGAACTGTAGGGTCGTAAATTAG

Retrieve as FASTA