Entry information : HaPrx05 (HanXRQChr17g0543531)
Entry ID 1475
Creation 2005-07-12 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx05 (HanXRQChr17g0543531)
Name (synonym) HaPrx05 (HanXRQChr17g0543531)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx05
start..stop
S start..stop
LsaPrx31 591 0 1..324 1..325
LvPrx31 588 0 1..322 1..323
LsPrx31 556 0 1..307 1..308
LperPrx31-1 525 0 23..303 1..281
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 34714782..34714979 198 N° 2 34714272..34714469 198 N° 3 34714006..34714168 163 N° 4 34711757..34712172 416
complement(join(34711757..34712172,34714006..34714168,34714272..34714469,3471478 2..34714979))


exon

Literature and cross-references HaPrx05 (HanXRQChr17g0543531)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L., Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison ,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project Unpublished (2002). Genoplante
DNA ref. HanXRQ genome:   HanXRQChr17 (34714979..34711757)
EST ref. GenBank:   DY922862.1 [5' end]
Cluster/Prediction ref. HanXRQ:   HanXRQChr17g0543531
Protein sequence: HaPrx05 (HanXRQChr17g0543531)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (305)
PWM (Da):   %s   35465.96 (33144.7)  
PI (pH):   %s   6.65 (6.03) Peptide Signal:   %s   cut: 20 range:20-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKGFCWILVFLVVLRWVQCDLQMGYYGSSCPKAEKIVQDYVNEHIPNAPSLAAALIRMHFHDCFVKGCDASILLNVTSSSGNQTEKVAIPNQTVRGFDFIDRLKSLVEAECPGIVSCADIIALAARDSIAITGGPSWKVPTGRRDGLLSNASEALNQIPAPFDNITILIQKFANKSLDLKDLVLLSGAHTIGIAHCPSVSNRLYNFTGVGDRDPSLDSEYADNLRATKCRTQNDTTTILEMDPGSRKTFDLSYYTLLLKRRGLFESDSALTTNSNTLAYINQLLQGSLQNFFSEFALSMEKMGQIEVKTGTSGEIRRNCAVVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGGTTTTTGCTGGATTTTGGTTTTTCTAGTGGTTTTGAGATGGGTACAATGTGATTTGCAGATGGGATATTATGGGAGTTCGTGCCCGAAAGCCGAAAAGATTGTGCAAGACTAT
GTGAATGAGCATATCCCGAATGCCCCATCGCTTGCGGCTGCTCTTATCAGAATGCATTTTCATGATTGTTTCGTCAAG
GTTCGTTTCATTTTCTAGCTACCTTTTTTCGTGTCATATATC
ATGACAGTTTTTAAATATCATTGTTCATATATTTAAACAAAACTCGACTGCTGTACGCGAGTAGTGTGCTTGTTAAACGATGAAAACAAGCACACGCTTATTTTGGAGTTTAGATATCCC
AACTTCGGTTTAAATCAAGAATGCTATTATTTAACGCGTCCAAAATGATTATTCTAACCTCAATACGAGATTACTATTTGATTGTTTTACTACATTCCACACGTATGATTATTATTTTTA
CCCATAAGGCAACATGGTTGTTTTGAATAGGGTTGTGATGCATCAATCCTCTTGAATGTTACTTCAAGCTCAGGGAATCAGACAGAGAAAGTGGCAATACCAAACCAAACAGTAAGAGGG
TTTGATTTCATTGATAGATTGAAGAGTTTAGTTGAAGCAGAATGCCCTGGCATTGTTTCTTGTGCTGATATTATTGCTCTTGCTGCTAGAGACTCCATTGCTATCACT
GTAAGAATTCAA
ATTTCATTACAAAAAGAAAACGAACCGAATGTAATTCCCAAATAGATGTTTTTGGTTCTGATTTCTTTTGTTGTTTTCGGTTTTATTAAAGGGAGGCCCTTCTTGGAAAGTCCCGACGGG
GCGAAGAGATGGGTTGTTATCCAATGCATCCGAGGCGTTAAACCAAATCCCGGCTCCATTCGACAATATCACTATCCTCATACAAAAGTTTGCCAATAAAAGTCTTGATTTGAAGGATCT
TGTTTTGCTTTCCG
GTACGTTATTTTTTTTTTTTACTTTAGTGCTCTTTTCGTCCATGTGATTTGATGAGTTTTGTCATTTCAATCAAAATTCTTAAATTTTGTCATTTATATGTTGTGC
TTTCCCTTGTGCACTGCAATGGTCTAACACAATCCAATTTAATTGCTAAATCCCCATGTGAGGATGTCTTTTTTAACCTTCAACTCATTAAAAAATGAGTTGTTTATACTTCATAGAAAA
AAAAAAATAGACCATAGTAATTTTAAAACCAACAAAAAAAAACCATAGAACATGTATGCGTTTGAATCTAGATCAATATCGATCCTGTCTAAGGATCTCCAAGAACCAGTCTTCCTGTTG
ACAAATTTAGTAATAAACATGATTTAGAAAATGATTTGATGGTATATCTTTTTTTTTTTTTTTTTTCAAAAAAGCATGAACTTTCCTAATAGCCTATGAAATACATTACATAAATTTTAA
TTTGTGTTTTCTTGTAATTTTCTTTATATATTGTTGTGTTGTAAAAATCGCGACTAGTCGGCTATTAATCGCTAGCCGGCCATTAAATGAGTAATTTTTCATTAATCAGCCCATTAATCG
CTAGTTGGCCTAGTCGGCTAGCCAAAAATCGGTGATTCCGGCCAGATTCCGGCAAAAAAACCTTTATATTCCAGCCAAAACCTCTAAATTCCGGCCAGTTTCCAACTAAACCATGTGAAT
TCTAACAATTAATCTTGTATACTTAAAAAATGAGATGAGTAAGACTTAAAACCTAGCTACTTAAAATATTTACCTATAAAAATATGTATATGTATACATAAAACTGAAAATTACATATAA
AAACCCGATCCAGTTACTCTCGAGTAGTCGCTAGTCCCCACCTCAACTACCGACTAGCGATAGCGAGTTCTCTAACCTTATTTTTTTTTGTTAGATTTAAAACTAAAAGTTATTGGAATT
CTTATTAAAAGAATATTTTAGCTATTTTATATTGGCTTGATCAAACCCATTTTTTTATTGGTTGAAGGTTAAAACACTAAAGAGAAAAGTACACATATTACATATTGTCTTTGCAATCAG
TCAAAATTTTGGATTTAGCAGTTGTTCCATATTATTTGCACTTTATAATGTATTTACTTCTTAACTTTTATCAAAATTACACAGAAGGTTCTAATGGTTTGCGTAGATAGATGGTCCATA
TTATTTGCACTTTATAACGTATTTACTTCTTAACTTTTATCAAAATTACACAGAAGGTTCTAATGGTTTGCAGTATATGACGCATTTGTTCCCCAACTTTTAGTGATTAAATGCATTACA
AAGTGCAACCCACGGGACCATCCTTGTACTTCTGTCAAAAGTTGAGGACTAAATGTATTACAAAGTACAAACCAAAAGGACCATACGTGTATTTCTGGAAAGCGAAGGACTAAATCCACA
ATTTTATTAACCATAGGGACCATCCGTATACTTTACTCAAAACTAAATTACCCTCATGGCCACATATGGGGTGCACGTTGGGGGTAAAAACAGAAAAAATTGATGGTGATCATAGGCAAT
TGGAGTGAAAGTAACGTCAAAATATGACAAGATTTAAGTAGTTGAATCAAAATGCCAAAACGGATCAAACCATGTAGACGAAAACAACACTTAACCCTTTTTACGTAATTGGATGAAATT
TAATGCATTTTGTTTTAGTATGTCACACGGAACAATGTGACTTTAATCAAACCCGAGCCATAACAGAAGGTCACAATGTGACTACAAAGCCCTTCAACTTTTTTTTTTTTTGCTAAATTT
AAGATGTTACTCATTCAAGGTTTCACATATTTGTGACGTTATATTAGGTGCTCATACTATTGGGATCGCACATTGTCCATCGGTATCAAACCGTCTATACAATTTCACGGGTGTGGGAGA
TCGAGACCCCTCCCTTGATAGCGAATATGCAGACAATCTCAGAGCAACAAAATGCAGGACACAAAACGACACTACAACAATACTTGAGATGGATCCTGGGAGCCGTAAGACTTTTGATCT
TAGCTACTACACGTTATTGCTAAAACGTAGGGGCTTGTTCGAGTCTGATTCGGCTTTGACTACAAACTCCAACACGTTGGCATACATAAACCAACTTCTTCAAGGATCGCTCCAGAATTT
CTTCAGTGAGTTTGCATTGTCGATGGAGAAAATGGGTCAAATTGAGGTGAAAACCGGAACCTCTGGTGAAATTCGAAGGAATTGTGCTGTCGTAAATAGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGGTTTTTGCTGGATTTTGGTTTTTCTAGTGGTTTTGAGATGGGTACAATGTGATTTGCAGATGGGATATTATGGGAGTTCGTGCCCGAAAGCCGAAAAGATTGTGCAAGACTAT
GTGAATGAGCATATCCCGAATGCCCCATCGCTTGCGGCTGCTCTTATCAGAATGCATTTTCATGATTGTTTCGTCAAG
GGTTGTGATGCATCAATCCTCTTGAATGTTACTTCAAGCTCA
GGGAATCAGACAGAGAAAGTGGCAATACCAAACCAAACAGTAAGAGGGTTTGATTTCATTGATAGATTGAAGAGTTTAGTTGAAGCAGAATGCCCTGGCATTGTTTCTTGTGCTGATATT
ATTGCTCTTGCTGCTAGAGACTCCATTGCTATCACT
GGAGGCCCTTCTTGGAAAGTCCCGACGGGGCGAAGAGATGGGTTGTTATCCAATGCATCCGAGGCGTTAAACCAAATCCCGGCT
CCATTCGACAATATCACTATCCTCATACAAAAGTTTGCCAATAAAAGTCTTGATTTGAAGGATCTTGTTTTGCTTTCCG
GTGCTCATACTATTGGGATCGCACATTGTCCATCGGTATCA
AACCGTCTATACAATTTCACGGGTGTGGGAGATCGAGACCCCTCCCTTGATAGCGAATATGCAGACAATCTCAGAGCAACAAAATGCAGGACACAAAACGACACTACAACAATACTTGAG
ATGGATCCTGGGAGCCGTAAGACTTTTGATCTTAGCTACTACACGTTATTGCTAAAACGTAGGGGCTTGTTCGAGTCTGATTCGGCTTTGACTACAAACTCCAACACGTTGGCATACATA
AACCAACTTCTTCAAGGATCGCTCCAGAATTTCTTCAGTGAGTTTGCATTGTCGATGGAGAAAATGGGTCAAATTGAGGTGAAAACCGGAACCTCTGGTGAAATTCGAAGGAATTGTGCT
GTCGTAAATAGTTAA

Retrieve as FASTA