Entry information : HaGrxC07-1C
Entry ID 14771
Creation 2017-11-23 (Catherine Mathe (Scipio))
Last sequence changes 2018-01-04 (Catherine Mathe (Scipio))
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC07-1C
Name HaGrxC07-1C
Class CGYC Grx    [Orthogroup: GrxC003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC07-1C
start..stop
S start..stop
HaGrxC18 186 1e-63 1..93 1..93
HaGrxC26 186 2e-63 1..93 1..93
HaGrxC22 186 2e-63 1..93 1..93
HaGrxC15 186 2e-63 1..93 1..93
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 192675224..192675366 143 N° 2 192674939..192675080 142  
complement(join(192674939..192675080,192675224..192675366))


exon

Literature and cross-references HaGrxC07-1C
DNA ref. HanXRQ genome:   HanXRQChr13 (192675366..192674939)
Protein sequence: HaGrxC07-1C
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   94 (70)
PWM (Da):   %s   10649.66 (8039.4) Transmb domain:   %s   i7-24o75-93i
PI (pH):   %s   9.07 (9.52) Peptide Signal:   %s   cut: 25 range:25-94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTSSSIFILFFTIATLFTSNTEASSVDFVKKIVSSHSIVIFSKSYYPYCKRAKGVFKELNAKPYVLEIDERGEWFWILLFALLVIALVLNNF*

Retrieve as FASTA  
Remarks Warnings: Equal sequence : 14409;14411;14418;14419;14426;14430 Incomplte: mismatches,in-frame stopcodon,
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACCAGTTCTTCCATTTTCATCCTCTTCTTCACCATTGCCACCCTCTTCACATCCAATACCGAAGCATCATCCGTCGATTTCGTCAAGAAAATAGTCTCTTCTCACTCCATAGTC
ATCTTCTCCAAATCTTACTATCC
GTACGTATTTTTCATTTCATATGATATCCCTATCAGTTCCGCATTCGTTTAATTGTGTATTAAGAAATTATTTATATTTTTGATTTGTTTATTATTG
GTATAAATATTTGAAAATGTTTTTTTAATATTGTGTTGATCATCAGGTATTGTAAAAGGGCTAAAGGTGTATTCAAGGAGTTGAATGCGAAACCGTATGTACTCGAGATCGATGAGAGAG
GTGAATGGTTTTGGATTCTTTTATTTGCACTTCTTGTTATTGCTCTTGTGCTAAATAATTTCTAAATT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACCAGTTCTTCCATTTTCATCCTCTTCTTCACCATTGCCACCCTCTTCACATCCAATACCGAAGCATCATCCGTCGATTTCGTCAAGAAAATAGTCTCTTCTCACTCCATAGTC
ATCTTCTCCAAATCTTACTATCC
GTATTGTAAAAGGGCTAAAGGTGTATTCAAGGAGTTGAATGCGAAACCGTATGTACTCGAGATCGATGAGAGAGGTGAATGGTTTTGGATTCTTTTA
TTTGCACTTCTTGTTATTGCTCTTGTGCTAAATAATTTCTAAATT

Retrieve as FASTA