Entry information : HaGrxC07-1E
Entry ID 14773
Creation 2017-11-23 (Catherine Mathe (Scipio))
Last sequence changes 2018-01-04 (Catherine Mathe (Scipio))
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC07-1E
Name HaGrxC07-1E
Class CGYC Grx    [Orthogroup: GrxC003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC07-1E
start..stop
S start..stop
HaGrxC26 189 8e-65 1..95 1..95
HaGrxC22 189 8e-65 1..95 1..95
HaGrxC15 189 8e-65 1..95 1..95
HaGrxC07-1D 189 8e-65 1..95 1..95
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 64459770..64459912 143 N° 2 64459482..64459626 145  
complement(join(64459482..64459626,64459770..64459912))


exon

Literature and cross-references HaGrxC07-1E
DNA ref. HanXRQ genome:   HanXRQChr16 (64459912..64459482)
Protein sequence: HaGrxC07-1E
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   95 (71)
PWM (Da):   %s   10762.75 (8152.5) Transmb domain:   %s   i7-24o75-94i
PI (pH):   %s   9.07 (9.52) Peptide Signal:   %s   cut: 25 range:25-95
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTSSSIFILFFTIATLFTSNTEASSVDFVKKIVSSHSIVIFSKSYYPYCKRAKGVFKELNAKPYVLEIDERGEWFWILLFALLVIALVLNNFLI

Retrieve as FASTA  
Remarks Warnings: Equal sequence : 14409;14411;14418;14419;14426;14430
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACCAGTTCTTCCATTTTCATCCTCTTCTTCACCATTGCCACCCTCTTCACATCCAATACCGAAGCATCATCCGTCGATTTCGTCAAGAAAATAGTCTCTTCTCACTCCATAGTC
ATCTTCTCCAAATCTTACTATCC
GTACGTATTTTTCATTTCATATGATATCCCTATCAGTTCCGCATTCGTTTAATTGTGTATTAAGAAATTATTTATATTTTTGATTTGTTTATTATTG
GTATAAATGTTTGAAAATGTTTTTTTAATATTGTGTTGATCATCAGGTATTGTAAAAGGGCTAAAGGTGTATTCAAGGAGTTGAATGCGAAACCGTATGTACTCGAGATCGATGAGAGAG
GTGAATGGTTTTGGATTCTTTTATTTGCACTTCTTGTTATTGCTCTTGTGCTAAATAATTTCTTAATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACCAGTTCTTCCATTTTCATCCTCTTCTTCACCATTGCCACCCTCTTCACATCCAATACCGAAGCATCATCCGTCGATTTCGTCAAGAAAATAGTCTCTTCTCACTCCATAGTC
ATCTTCTCCAAATCTTACTATCC
GTATTGTAAAAGGGCTAAAGGTGTATTCAAGGAGTTGAATGCGAAACCGTATGTACTCGAGATCGATGAGAGAGGTGAATGGTTTTGGATTCTTTTA
TTTGCACTTCTTGTTATTGCTCTTGTGCTAAATAATTTCTTAATTTGA

Retrieve as FASTA