Entry information : HaPrx08 (HanXRQChr17g0550071)
Entry ID 1478
Creation 2005-08-11 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx08 (HanXRQChr17g0550071)
Name (synonym) HaPrx08 (HanXRQChr17g0550071)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx08
start..stop
S start..stop
VvPrx65 536 0 13..326 9..322
CsPrx20 521 0 7..326 7..326
CclPrx43 518 0 7..326 5..324
LvPrx03 514 0 6..306 4..305
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 64696300..64696515 216 N° 2 64696014..64696205 192 N° 3 64694762..64695334 573  
complement(join(64694762..64695334,64696014..64696205,64696300..64696515))


exon

Literature and cross-references HaPrx08 (HanXRQChr17g0550071)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L., Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison ,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project Unpublished (2002).
DNA ref. HanXRQ genome:   HanXRQChr17 (64696515..64694762)
Cluster/Prediction ref. HanXRQ:   HanXRQChr17g0550071 UniGene:   Han.4036 [3' end]
Protein sequence: HaPrx08 (HanXRQChr17g0550071)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (301)
PWM (Da):   %s   34888.34 (32132.9) Transmb domain:   %s   i9-28o
PI (pH):   %s   5.28 (5.03) Peptide Signal:   %s   cut: 26 range:26-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MADTPQRTIIYWLFIVAVLTGTAHGQLIENFYASTCPMVEAIVKQTVNTKVSQTFTTIPATLRLFFHDCFVEGCDASVIIASPNGDAEKDSSDNLSLAGDGFDTVIKAKQAVEAVCPGVVSCADVLAIAARDVVVAAGGPLFNVQLGRRDGLISKASRVEGNLPLPTFNVNQLNTMFARHNLTQLDMIALSGAHTLGFSHCNRFANRLYSFSSSSKVDPSLDPTYAQQLMASCPQNVAPDIAINMDPVTAQTFDNVYYQNLVAGKGLFTSDQVLFTNPSTQSTVNDFANNPGDFNGAFITAMRKLGQTGVKTGNQGEIRRDCTAFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 10 ESTs .
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGATACACCACAGAGAACCATCATATACTGGTTGTTTATAGTTGCGGTCCTGACCGGAACAGCACATGGTCAGCTGATCGAGAATTTTTATGCTTCAACATGTCCTATGGTTGAA
GCCATCGTGAAACAAACGGTTAACACTAAGGTTAGCCAGACATTTACGACGATTCCAGCCACCCTTCGTCTGTTTTTTCATGATTGTTTCGTTGAG
GTACGTATGTTTTAATGGTTTTGT
GTTGTGTTGTGTTTTTTTTTCTTTTTTTTTAGTTGGGTATTTAGGCTGTTTTTTCATGCAAAATATGTAGGGGTGTGATGCTTCGGTGATTATAGCGTCACCAAATGGGGATGCGGAAAA
GGACTCTTCGGATAATTTGTCGCTCGCGGGGGATGGGTTTGATACTGTTATTAAAGCTAAACAGGCGGTTGAGGCGGTTTGTCCTGGTGTTGTTTCGTGTGCTGATGTTTTAGCCATTGC
TGCCCGTGATGTTGTGGTCGCG
GTAAGATCTTCTTACGCTTTATGGGGTAAATGATTGGTCTGATAACGGATTAAAGCAGGTCGGGTCAGGTCAGGTCATATTTACTATTGAGTGGAACA
AGTAAACAACCAAAAGTTTTAAAAGTTGTTTGTTAATAGCAAAGTCACACACATTTTACATTCTAAAGTCTAGACTCTAGAGGAGTTCATAGCCGCTAGTCGGTTTTGACGAATGTTCTG
AGCCGAAGTGCCAACTACGGTTTTGGGAACAAGTCAAACCGGCCAAGTTGGGTGGGTCGCTGAAACAATCAGTTTGACAGTTTAAACCCATATTTTATTTTTTTAGAAAAAATATATGTT
TGTATCAAAACTTTAAAATGACACATTATTCATGATGATAATACATATGCATAACTAAATTTTTGTAAAATAGAAAAATATATAAGCAATAAAAGTTAAACAGCAGGTTACAAGTTCCAA
TTGAGCTCAAGTGTTAAATAGACAAAAGTCATAACCGAACCGTTTGGATCTCAAACCAGCTGACTTTCTTCGATTTCGACTGTTTGATCATTTTCAATAATTTGTGAACACCTGTATTCT
ACACCAATGTCTCAAAGTGACACATAAGAATCACCTTCATGACATGAAACTTAATATATAACCAAATTTGCTGTTGTAAACTGCTTAATCTATCTGTGCAGGCTGGGGGGCCTTTGTTCA
ACGTCCAATTAGGCAGGCGAGACGGGCTCATTTCAAAGGCTTCACGGGTCGAAGGTAACCTTCCGTTACCCACATTCAACGTCAACCAACTTAACACCATGTTCGCCAGGCACAACCTCA
CACAGCTCGACATGATCGCCCTCTCCGGAGCCCACACGCTCGGTTTTTCCCACTGCAACCGTTTCGCTAACCGTCTATACTCATTTTCGTCATCCTCCAAGGTTGACCCGTCACTGGACC
CAACCTACGCTCAGCAACTTATGGCTTCTTGCCCTCAAAATGTGGCCCCCGATATCGCCATAAACATGGATCCTGTAACCGCGCAAACCTTTGACAATGTTTATTACCAAAACCTAGTTG
CCGGCAAGGGTTTGTTTACATCGGATCAAGTTCTGTTCACCAACCCGTCGACTCAGTCAACGGTTAATGACTTTGCCAACAACCCAGGGGACTTTAACGGCGCGTTTATAACCGCCATGA
GGAAGCTCGGTCAGACAGGTGTCAAAACCGGCAACCAAGGAGAGATAAGAAGGGATTGCACAGCTTTTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGATACACCACAGAGAACCATCATATACTGGTTGTTTATAGTTGCGGTCCTGACCGGAACAGCACATGGTCAGCTGATCGAGAATTTTTATGCTTCAACATGTCCTATGGTTGAA
GCCATCGTGAAACAAACGGTTAACACTAAGGTTAGCCAGACATTTACGACGATTCCAGCCACCCTTCGTCTGTTTTTTCATGATTGTTTCGTTGAG
GGGTGTGATGCTTCGGTGATTATA
GCGTCACCAAATGGGGATGCGGAAAAGGACTCTTCGGATAATTTGTCGCTCGCGGGGGATGGGTTTGATACTGTTATTAAAGCTAAACAGGCGGTTGAGGCGGTTTGTCCTGGTGTTGTT
TCGTGTGCTGATGTTTTAGCCATTGCTGCCCGTGATGTTGTGGTCGCG
GCTGGGGGGCCTTTGTTCAACGTCCAATTAGGCAGGCGAGACGGGCTCATTTCAAAGGCTTCACGGGTCGAA
GGTAACCTTCCGTTACCCACATTCAACGTCAACCAACTTAACACCATGTTCGCCAGGCACAACCTCACACAGCTCGACATGATCGCCCTCTCCGGAGCCCACACGCTCGGTTTTTCCCAC
TGCAACCGTTTCGCTAACCGTCTATACTCATTTTCGTCATCCTCCAAGGTTGACCCGTCACTGGACCCAACCTACGCTCAGCAACTTATGGCTTCTTGCCCTCAAAATGTGGCCCCCGAT
ATCGCCATAAACATGGATCCTGTAACCGCGCAAACCTTTGACAATGTTTATTACCAAAACCTAGTTGCCGGCAAGGGTTTGTTTACATCGGATCAAGTTCTGTTCACCAACCCGTCGACT
CAGTCAACGGTTAATGACTTTGCCAACAACCCAGGGGACTTTAACGGCGCGTTTATAACCGCCATGAGGAAGCTCGGTCAGACAGGTGTCAAAACCGGCAACCAAGGAGAGATAAGAAGG
GATTGCACAGCTTTTAACTAA

Retrieve as FASTA