Entry information : HaPrx36 (HanXRQChr14g0441921)
Entry ID 1480
Creation 2005-08-11 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx36 (HanXRQChr14g0441921)
Name (synonym) HaPrx36 (HanXRQChr14g0441921)
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx36
start..stop
S start..stop
AanPrx01 596 0 1..327 1..328
LvPrx15 592 0 1..327 1..328
LsaPrx15 562 0 1..327 1..328
LperPrx15 546 0 1..312 1..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 107653573..107653782 210 N° 2 107653871..107654071 201 N° 3 107654167..107654332 166 N° 4 107654875..107655281 407
join(107653573..107653782,107653871..107654071,107654167..107654332,107654875..1 07655281)


exon

Literature and cross-references HaPrx36 (HanXRQChr14g0441921)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L., Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison ,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project Unpublished (2002).
DNA ref. HanXRQ genome:   HanXRQChr14 (107653573..107655281)
EST ref. GenBank:   BU025062 [Fragment]
Cluster/Prediction ref. HanXRQ:   HanXRQChr14g0441921
Protein sequence: HaPrx36 (HanXRQChr14g0441921)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (304)
PWM (Da):   %s   35272.63 (32733.2) Transmb domain:   %s   o4-23i
PI (pH):   %s   8.91 (8.73) Peptide Signal:   %s   cut: 24 range:24-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRVTFIQVFALSLLIFSNLAFAQLRQNYYANICPNVETIVRNAVTAKVRQTFVTIPGTLRMFFHDCFVQGCDASVLIASSGSNTAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPACRNKVSCADILTMATRDVVVAAGGPSYAVELGRLDGLSSTAASVGGKLPKPNMNLDQLNAMFASHGLTQADMIALSGAHTLGFSHCNQFTNRIYNFSKQNPVDPTLNPNYATQLQQQCPKNVDPRIAVNMDPNTPRKFDNVYYKNLQQGQGLFTSDQVLFTDSRSKQTVNAWASSSQAFNNAFVTAMTKLGRVGVKTGQNGNIRRDCSAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGGGTCACTTTTATTCAAGTATTTGCTCTTTCACTTCTCATCTTCTCAAACTTAGCTTTTGCTCAACTCAGACAAAACTACTACGCAAACATCTGCCCGAATGTGGAAACGATC
GTCCGCAACGCAGTCACAGCTAAGGTTCGCCAGACATTCGTCACCATCCCAGGAACTCTTCGCATGTTTTTCCACGATTGTTTCGTTCAG
GTTCGCTGATATTGTTTGTTGGTATTAAAT
ACAATGCATTGATTAACGTTTAAGATTATAACGTGTTGTGTTTTGGGTTAATAAATAGGGGTGTGATGCTTCAGTTTTGATAGCATCAAGCGGGTCCAACACTGCAGAGAAAGATCATCC
GGATAACCTGTCATTGGCTGGGGACGGGTTTGATACGGTTATCAAAGCGAAAGCTGCAGTTGATGCTGTCCCGGCTTGCAGAAATAAAGTGTCGTGTGCGGATATTCTCACCATGGCTAC
ACGGGATGTTGTCGTGGCG
GTACTATTGTACTAATTGATACTTCATGTATTTAATAAACAGTTGAAGTAGTTTTGATAATGACATGTGATATAATGGTTGGTGGTTTTTTGCAGGCAGGT
GGGCCATCGTATGCGGTGGAGCTAGGAAGGTTAGACGGGCTGAGTTCAACGGCAGCTAGTGTGGGTGGGAAGCTTCCGAAACCAAACATGAATTTGGATCAACTTAATGCCATGTTTGCT
TCACATGGGTTGACCCAAGCCGACATGATTGCGCTCTCAG
GTAACAAGTTAATGCAGAAACAAACCGGAGTTGATAATAAATGGACTCCCATTGTAAAAGTGTCCATTTCGACCCGTTGA
CTTATGAATTGCCTGATTTTAGTTACATTTTAACTCTAACGGGTAAAACAGTTAAACGAAGAATATCTATAAAGAAGTAGGTAAGATGGGTCACACCGGTCAATCGTTAGAGGTGTATTT
TTACCGTGTAAAACCTTCTAATTTTTTTTTACTAAAATAACAGATGGCTGCTAAAGTTCTAAAAAGTTATTTTTGTCGTGCAAAACCTTCTAAAACATTTTTACTAAAATATTAGATTGC
TGCTAAAGTTCTAAAAACGTTTTGTAATTATATTTACCACACTAATTTTTTTATTTTTTTTATTCGAGTGTTATGCTTTTTAAGAGAATAGAATGTGTTTCAGGTCAATCCATATTTTAA
TCCTTTTGGACCTTTTTTATGGGAATTTTAAAAACTATCATAAGGTATTTTATGGTTTCTTAAACATTTTATAAAAAACGCAACGTTAATTACGATGTCCAGGTGCACACACTCTTGGAT
TCTCGCATTGCAACCAATTCACAAACAGGATATACAACTTCAGCAAGCAGAACCCGGTTGATCCAACTCTAAACCCAAATTATGCGACCCAATTGCAGCAACAGTGTCCAAAGAACGTTG
ACCCGCGGATAGCTGTAAACATGGATCCAAACACACCAAGAAAATTTGACAACGTGTACTACAAGAACCTGCAGCAAGGACAAGGATTATTTACTTCTGACCAGGTTCTCTTCACTGACT
CAAGGTCAAAACAGACCGTGAACGCATGGGCCTCCAGCTCACAAGCTTTCAATAACGCGTTTGTTACAGCTATGACTAAACTAGGTCGGGTTGGAGTCAAGACGGGTCAAAATGGAAATA
TCAGACGAGATTGTTCCGCATTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGGGTCACTTTTATTCAAGTATTTGCTCTTTCACTTCTCATCTTCTCAAACTTAGCTTTTGCTCAACTCAGACAAAACTACTACGCAAACATCTGCCCGAATGTGGAAACGATC
GTCCGCAACGCAGTCACAGCTAAGGTTCGCCAGACATTCGTCACCATCCCAGGAACTCTTCGCATGTTTTTCCACGATTGTTTCGTTCAG
GGGTGTGATGCTTCAGTTTTGATAGCATCA
AGCGGGTCCAACACTGCAGAGAAAGATCATCCGGATAACCTGTCATTGGCTGGGGACGGGTTTGATACGGTTATCAAAGCGAAAGCTGCAGTTGATGCTGTCCCGGCTTGCAGAAATAAA
GTGTCGTGTGCGGATATTCTCACCATGGCTACACGGGATGTTGTCGTGGCG
GCAGGTGGGCCATCGTATGCGGTGGAGCTAGGAAGGTTAGACGGGCTGAGTTCAACGGCAGCTAGTGTG
GGTGGGAAGCTTCCGAAACCAAACATGAATTTGGATCAACTTAATGCCATGTTTGCTTCACATGGGTTGACCCAAGCCGACATGATTGCGCTCTCAG
GTGCACACACTCTTGGATTCTCG
CATTGCAACCAATTCACAAACAGGATATACAACTTCAGCAAGCAGAACCCGGTTGATCCAACTCTAAACCCAAATTATGCGACCCAATTGCAGCAACAGTGTCCAAAGAACGTTGACCCG
CGGATAGCTGTAAACATGGATCCAAACACACCAAGAAAATTTGACAACGTGTACTACAAGAACCTGCAGCAAGGACAAGGATTATTTACTTCTGACCAGGTTCTCTTCACTGACTCAAGG
TCAAAACAGACCGTGAACGCATGGGCCTCCAGCTCACAAGCTTTCAATAACGCGTTTGTTACAGCTATGACTAAACTAGGTCGGGTTGGAGTCAAGACGGGTCAAAATGGAAATATCAGA
CGAGATTGTTCCGCATTTAATTAA

Retrieve as FASTA