Entry information : HaKat[P]03-1A
Entry ID 14845
Creation 2017-11-23 (Catherine Mathe (Scipio))
Last sequence changes 2018-01-29 (Catherine Mathe (Scipio))
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaKat[P]03-1A
Name HaKat[P]03-1A
Class Catalase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaKat[P]03-1A
start..stop
S start..stop
HaKat[P]03 97 1e-28 1..51 1..51
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 42868470..42868523 54 N° 2 42868115..42868213 99  
complement(join(42868115..42868213,42868470..42868523))


exon

Literature and cross-references HaKat[P]03-1A
DNA ref. HanXRQ genome:   HanXRQChr06 (42868523..42868115)
Protein sequence: HaKat[P]03-1A
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   51
PWM (Da):   %s   5731.82  
PI (pH):   %s   8.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTAWGFWSKQACGNLAKCLKEVKGDVFQGDDDYPLKACHPLMLHVFFKFLE

Retrieve as FASTA  
Remarks Incomplte: mismatches,gap to queryend,
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGGCTTGGGGGTTTTGGTCGAAACAAGCATGTGGAAATCTAGCCAAGTGTGTATACACTTGAGGTGAGTTCATAACCCCTCTTTTCTAATTGTTTTTAAATATTATTGCGACTGAT
CATGTAAAAAGAGTTAATTGTCTCGGAAGGGATTATTAAATCGTATATTGACGGTTATAATGTAAGTAGCTGAATGTCCCATTTAGGTGACCTCCAGTGTTGTTTTGAATAGGATTGAAA
GGGATATGTTCTAATGATTTAATTAACCATATAAAATATTTATGTGTTTTAGGGATGATTGTGAGCTGAGTTGAAAGAGGTCAAAGGTGATGTGTTTCAAGGTGACGACGACTACCCACT
TAAAGCATGCCACCCACTGATGTTACATGTGTTCTTCAAATTCTTAGAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGGCTTGGGGGTTTTGGTCGAAACAAGCATGTGGAAATCTAGCCAAGTGTTTGAAAGAGGTCAAAGGTGATGTGTTTCAAGGTGACGACGACTACCCACTTAAAGCATGCCACCCA
CTGATGTTACATGTGTTCTTCAAATTCTTAGAG

Retrieve as FASTA