Entry information : HaPrx15 (HanXRQChr02g0042661)
Entry ID 1485
Creation 2007-09-06 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx15 (HanXRQChr02g0042661)
Name (synonym) HaPrx15 (HanXRQChr02g0042661)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type Protoplasts
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx15
start..stop
S start..stop
LsaPrx32 668 0 1..359 1..358
LperPrx32 661 0 7..359 17..369
LsePrx32 632 0 1..346 1..345
LsPrx32 535 0 1..290 1..289
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 80531983..80532231 249 N° 2 80532328..80532522 195 N° 3 80534103..80534738 636  
join(80531983..80532231,80532328..80532522,80534103..80534738)


exon

Literature and cross-references HaPrx15 (HanXRQChr02g0042661)
Literature Tamborindeguy,C., Ben,C., Liboz,T. and Gentzbittel,L. Sequence evaluation of four specific cDNA libraries for developmental genomics of sunflower
Mol. Genet. Genomics 271 (3), 367-375 (2004)
DNA ref. HanXRQ genome:   HanXRQChr02 (80531983..80534738)
EST ref. GenBank:   DY916029 [5' end]
Cluster/Prediction ref. HanXRQ:   HanXRQChr02g0042661 UniGene:   Han.1936
Protein sequence: HaPrx15 (HanXRQChr02g0042661)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359 (331)
PWM (Da):   %s   39287.63 (36320.1) Transmb domain:   %s   i7-26o
PI (pH):   %s   6.23 (6.34) Peptide Signal:   %s   cut: 29 range:29-359
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASCSTSLFLVFSSLLIFSSLLYVSEADYSAPITKGLSWDYHHKTCHKVEKIVRKHLKKVFDKDIGQAAGLLRLHFHDCFVQGCDGSVLLDGSHGGPSEQTAPPNQSLRKEAFDIIEDLRNLVHRECGRIVSCADIVALAARDAVHLSGGPDYDVPLGRKDGLSFATENATLANLPAPTSNATTILSALAVKNLTPTDVVALSGGHTIGVSHCSSFASRLYPTQDPTMEKTFAHGLKEVCPTNTTDATTAMDIYSPIKFDNKYFVDLMNRQGLFTSDQDLYTHKVTKPIVESFAHDEKLFFEAFVKAMIKMGQMEVLTGGKGEIRAHCSIRNPDNKAYFSYLVEEEDQSDLETRAELR*

Retrieve as FASTA  
Remarks Complete sequence from genomic and4 ESTs. Strain="ANN1312" and "Emil".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCTTGTTCAACCTCTTTGTTTCTAGTTTTCTCGTCTCTCTTGATCTTCTCATCTCTTCTTTACGTATCCGAAGCCGATTACTCCGCACCCATTACAAAAGGATTATCATGG
GATTACCACCACAAAACATGTCACAAAGTTGAAAAAATTGTTCGAAAACATCTCAAGAAAGTATTCGACAAGGATATCGGTCAAGCAGCGGGCTTGCTTCGACTTCACTTTCACGATTGT
TTTGTCCAG
GTAGCATTTAACTAAGCACATCATGGTTAATTATTATGATTAATTAAAGTAGTACGTATGTATGTATGTAATGATCATATATAATTATGCATGTAGGGATGTGATGGTTCG
GTATTGCTTGATGGGTCTCATGGTGGTCCGAGTGAACAAACCGCACCACCCAACCAAAGTCTACGAAAAGAGGCGTTCGACATCATCGAAGATCTACGGAATTTGGTCCATAGAGAATGC
GGGAGAATCGTGTCTTGTGCTGATATTGTTGCTCTTGCGGCTCGTGATGCTGTTCATCTG
GTACATATATAGTTACGATATGAATTCAAAATATATCCCTCACAATATTTTTACTTTTAA
CATAAAAATAGTCATGTTTACCATTGAAGTCCACAAGAATGAGGGGCTATTTGTTTATATCTTAATGGTTTAGAATTTTTATTGGTTCATCACTTAATTGTTTAGTCTATTTGTTTCGCG
AGCAGATATCTGAATGGTTAAACATTATAATAAGTTTGAATAGTTAAGACCTCTGATCTGAATTTGTCAAACATTTGCCTATGAACGGTTAAGCATTATACTGGCTTTTACTGATTCTGT
ACTTAATGGTTTAGATCTCTTACTGATCCAACACTTAACTAGAAGTTGCCTAAACAGCCCCTAGAAGTTGCCTAAACAGCCCCTGACTTGTATTCTTCACGCTGCAAACTTTTAATTGGC
ACAACAAATTCATATTGCTACACCAGATCCTCCACCAAGCTTATTTTTTAAACGATTTTTTGTAAATGTTTTTTCTAGTTTAATTTTTTTTTTATAAATTATTACTTCGTAACACTGCTT
TCTTTTTCTATTAACGTTTAACTTTTTCTAAAAAAAATATTTTATTTAATTAGTTGTAAATTTTATGTATTATGTTATAAAAATCTAATAAAAAACTATGGTAAAGCAATAAAACAGCTA
AGATATAAAGGTAAATACATAAAAATAGGGCTGCAAACGAACCGAACGAACACGAACAAGTCCTTGTTCGTGTTCGTTTGTTAAAAATATATGTGTTCACGAACTGTTTATGAACGCTTA
CCAAACGAGATTTTATGTTCGTGTTTGTTTGTTAAGGAAATGAACTTTTTCGTGTTCGTTTGTGTTTGTTTGTTCATGAACACAAACGAGCACAAACTAATGTTCATGAACACAAACGAG
CACAAACTAATGTTCATGAACACAAACGAGCACAAACTAATGTTCATGAACACAAATGGTAACAAACGAACACAAAAAAACGTTTATGAACAAAATACATAATACATTGACACTTATTAA
ATATTTTATTTTTCGGAATTTTGAAGTATTTAAATAAAATATAAAAGCTAAAAACACTAATGAACTATCAAACACAAACGAACACGTTACCGAACGTTCACGAACATAAATGAACGAATG
CACCCTCTGTTCATGTTTGTTCATTTAACTAAACGAACGAAATTTCTTGTTTGTGTTCGTTTGTTTAATAAACGAACGAACACAAACGAACTTCCCGCCGAACAGTTCACGAATTGTTCG
CCAAACGTCTGGTTCGTTTGCAACCCTACATAAAAAATAACAAATACAACTATAAAGTGTATTTTTTTTAACTTGATTTGTTAGATAAAAATAGAAGTAACACTTTTTTCGAATTTAAAA
AATGATAAATGATAAATTGGTAAATAAAAATATCAATGGTCATTTCAACAAGTTTTCCGGTCAAGATGAATAGTTTCTTTTGATTTTCCAACATTTTGGACCCACGTATATTTGGAAAAG
TATTTAACAAGTACTATATGTTAATAATTCAATTTACTAAATAAACTTGTTTTATCTTCTTTATATTTGTGTTACTAAAGTCAGGTGGACCGGACTATGATGTTCCATTGGGTAGAAAAG
ATGGTCTCTCATTCGCCACAGAAAACGCCACACTAGCCAACCTTCCAGCACCCACAAGTAATGCCACCACTATTCTTTCTGCGCTTGCCGTAAAAAACCTCACCCCAACAGATGTGGTGG
CCCTCTCTGGGGGCCACACTATCGGGGTGAGCCACTGCTCCTCCTTCGCCTCGCGTCTCTACCCCACCCAAGACCCCACCATGGAAAAAACCTTTGCCCATGGGCTCAAAGAGGTTTGTC
CCACCAACACCACCGATGCCACCACTGCCATGGACATTTACTCTCCAATCAAGTTCGACAACAAGTATTTCGTCGATTTGATGAACCGACAAGGGCTTTTTACCTCGGATCAAGATTTGT
ATACTCATAAAGTGACTAAACCAATTGTGGAAAGTTTTGCACATGATGAGAAGTTGTTCTTTGAGGCATTTGTGAAAGCCATGATCAAAATGGGACAAATGGAAGTGTTGACCGGTGGAA
AAGGAGAAATTCGTGCACATTGTTCTATTAGGAACCCTGATAACAAAGCGTATTTCTCTTATTTGGTTGAAGAAGAGGACCAGTCCGATCTCGAGACAAGGGCCGAATTGCGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCTTGTTCAACCTCTTTGTTTCTAGTTTTCTCGTCTCTCTTGATCTTCTCATCTCTTCTTTACGTATCCGAAGCCGATTACTCCGCACCCATTACAAAAGGATTATCATGG
GATTACCACCACAAAACATGTCACAAAGTTGAAAAAATTGTTCGAAAACATCTCAAGAAAGTATTCGACAAGGATATCGGTCAAGCAGCGGGCTTGCTTCGACTTCACTTTCACGATTGT
TTTGTCCAG
GGATGTGATGGTTCGGTATTGCTTGATGGGTCTCATGGTGGTCCGAGTGAACAAACCGCACCACCCAACCAAAGTCTACGAAAAGAGGCGTTCGACATCATCGAAGATCTA
CGGAATTTGGTCCATAGAGAATGCGGGAGAATCGTGTCTTGTGCTGATATTGTTGCTCTTGCGGCTCGTGATGCTGTTCATCTG
TCAGGTGGACCGGACTATGATGTTCCATTGGGTAGA
AAAGATGGTCTCTCATTCGCCACAGAAAACGCCACACTAGCCAACCTTCCAGCACCCACAAGTAATGCCACCACTATTCTTTCTGCGCTTGCCGTAAAAAACCTCACCCCAACAGATGTG
GTGGCCCTCTCTGGGGGCCACACTATCGGGGTGAGCCACTGCTCCTCCTTCGCCTCGCGTCTCTACCCCACCCAAGACCCCACCATGGAAAAAACCTTTGCCCATGGGCTCAAAGAGGTT
TGTCCCACCAACACCACCGATGCCACCACTGCCATGGACATTTACTCTCCAATCAAGTTCGACAACAAGTATTTCGTCGATTTGATGAACCGACAAGGGCTTTTTACCTCGGATCAAGAT
TTGTATACTCATAAAGTGACTAAACCAATTGTGGAAAGTTTTGCACATGATGAGAAGTTGTTCTTTGAGGCATTTGTGAAAGCCATGATCAAAATGGGACAAATGGAAGTGTTGACCGGT
GGAAAAGGAGAAATTCGTGCACATTGTTCTATTAGGAACCCTGATAACAAAGCGTATTTCTCTTATTTGGTTGAAGAAGAGGACCAGTCCGATCTCGAGACAAGGGCCGAATTGCGTTGA

Retrieve as FASTA