Entry information : HaPNC09-1
Entry ID 15177
Creation 2017-11-23 (Catherine Mathe (Scipio))
Last sequence changes 2018-04-25 (Catherine Mathe (Scipio))
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Bruno Savelli)
Peroxidase information: HaPNC09-1
Name HaPNC09-1
Class Plantacyanin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC09-1
start..stop
S start..stop
HaPNC21 258 3e-91 1..126 1..126
HaPNC19 258 3e-91 1..126 1..126
HaPNC13 258 3e-91 1..126 1..126
HaPNC10 258 3e-91 1..126 1..126
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6968093..6968270 178 N° 2 6967434..6967636 203  
complement(join(6967434..6967636,6968093..6968270))


exon

Literature and cross-references HaPNC09-1
DNA ref. HanXRQ genome:   HanXRQChr17 (6968270..6967434)
Protein sequence: HaPNC09-1
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   126 (97)
PWM (Da):   %s   13483.42 (10493.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.44 (4.54) Peptide Signal:   %s   cut: 30 range:30-126
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEGRGSVVVSMVVLCLLVVAFQCEVAQAATYVVGDDNGWTFSVAGWENGKNFNAGDVLVFNYPQGAHNVVVVNKESYDGCNTTPSEAKVYTSGNDQITLVKGYNNFICSYFGHCDSGMKIQIFVS

Retrieve as FASTA  
Remarks Warnings: Equal sequence : 14564;14565;14567;14573;14575
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAGGGAAGAGGCAGTGTAGTGGTGTCAATGGTGGTGCTTTGTCTACTAGTGGTGGCATTTCAATGCGAGGTAGCTCAAGCAGCTACTTATGTTGTCGGCGATGACAATGGCTGG
ACGTTTAGTGTTGCTGGCTGGGAAAACGGCAAGAATTTCAACGCAGGCGATGTCCTTG
GTATCCTCTCAACATGAGGTCACCACTTTTGTCACTTCAGTCCAAGAATGAAACGTTTTGCA
TCTGGGTCCTGATGTTTCATTTTTGTTGTCATTTTCATCCAATTGGCAAAGTGGGTTAGAATTTTCCGTTAACTACTCCCCTTTTTTTGGTTTCCTCATTTAAATGAAGGGTATAATCGT
CATTTTATGTCATAATATATTTAATTAAATGAGAAAAACGACAAAAAATGTTGAAGTTAACAGAAAATTCTAACTCAGATTGCCAATTGGATTAATATGGCAACAAAAATGAAACGTCAG
GTGCCCAGATGCAAAACGTTTCATTTTTGAACTGAAGTGGTAAAAGTGGCCTAAACTAAAAGACCATTTTGGCATTTTACACTAAAATATAATAGTTAAGTAATTACAAAGAAATGCTTA
TTTTAGTTCAATTGTTATTATATGATTGGAACAGTGTTTAACTACCCACAAGGAGCACATAATGTGGTGGTCGTGAACAAGGAAAGCTATGATGGGTGCAACACAACCCCAAGCGAAGCA
AAGGTGTACACAAGTGGAAATGACCAAATTACCCTTGTGAAGGGTTATAACAACTTCATTTGTAGTTACTTTGGTCACTGTGATAGTGGCATGAAGATTCAAATCTTTGTATCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAGGGAAGAGGCAGTGTAGTGGTGTCAATGGTGGTGCTTTGTCTACTAGTGGTGGCATTTCAATGCGAGGTAGCTCAAGCAGCTACTTATGTTGTCGGCGATGACAATGGCTGG
ACGTTTAGTGTTGCTGGCTGGGAAAACGGCAAGAATTTCAACGCAGGCGATGTCCTTG
TGTTTAACTACCCACAAGGAGCACATAATGTGGTGGTCGTGAACAAGGAAAGCTATGATGGG
TGCAACACAACCCCAAGCGAAGCAAAGGTGTACACAAGTGGAAATGACCAAATTACCCTTGTGAAGGGTTATAACAACTTCATTTGTAGTTACTTTGGTCACTGTGATAGTGGCATGAAG
ATTCAAATCTTTGTATCTTAA

Retrieve as FASTA