Entry information : CsorAPx01
Entry ID 15182
Creation 2018-04-27 (Christophe Dunand)
Last sequence changes 2018-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2018-04-27 (Christophe Dunand)
Peroxidase information: CsorAPx01
Name CsorAPx01
Class Ascorbate peroxidase    [Orthogroup: APx019]
Taxonomy Eukaryota Viridiplantae Chlorophyta Trebouxiophyceae Chlorellaceae Chlorella
Organism Chlorella sorokiniana    [TaxId: 3076 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsorAPx01
start..stop
S start..stop
CreAPx04 89 3e-24 1..134 3..131
VcaAPx02 88 7e-24 37..134 19..108
PpaAPx02 70 0.000000000000002 64..134 367..439
RobtAPx04 69 0.000000000000005 72..132 280..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2183579..2183818 240 N° 2 2184029..2184061 33 N° 3 2184241..2184309 69 N° 4 2184529..2184591 63
join(2183579..2183818,2184029..2184061,2184241..2184309,2184529..2184591)


exon

Literature and cross-references CsorAPx01
Protein sequence: CsorAPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   134
PWM (Da):   %s   14010.18 Transmb domain:   %s   i113-132o
PI (pH):   %s   10.2
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQAALAVPTAALARPRPALPSRKAVRARAGGPNGPLREFREDTGEVSTSGGESGGGASGSGAAPEKQQGQPKYIYADEQPPPRDTMSPEMKERLRREYYGLGGSPNKAMGSNYFLWIILGISFLAVLSKLTGAL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGCTGCGCTCGCTGTCCCCACCGCCGCCCTGGCGCGGCCCCGGCCCGCCCTGCCCTCTCGGAAGGCGGTGAGGGCCCGGGCAGGCGGTCCAAACGGTCCCCTGCGCGAGTTCCGT
GAGGACACGGGCGAGGTGAGCACCAGCGGCGGCGAGAGCGGCGGCGGCGCGAGCGGCAGCGGCGCCGCGCCCGAGAAGCAGCAGGGCCAGCCCAAGTACATCTACGCCGACGAACAGCCG
GTGAGTGGAGAGGGCAAGGCGGTGGCAGGGGTACGTTGTGGACGGCTGGGCAGATCGTTGCACTCACCGCCGCCCGCCCATCCGTCTCCCGTCCTGCCCTGCCGCACCCTTGCGCGCTCT
GCTGCTCGCTCCCAGCCAGGCGCTGGGCTGCCGCGCATATACAACAGACGAGTAGTCATATACACATGCCTCTGCCTCGTCCTTGTGCAGCCCCCTCGCGACACGATGAGCCCAGAGATG
AAG
GTGCGCCTGCTGCTGCTTTGGTGGCCGCTGCTGCTTGTTTGCTTGCATTGGCTGCCAGCCCTGCATGCCTCCTGTGCATCCTACGCCCTCGTATGCCTGAATGACCTGCACACACTT
GCACAGGAACGACAGCCCGCTGAGCCGCCTGCACCCTGCTCTGCTGCTCTGGCTGTGCGCAGGAGCGGCTGCGCCGCGAGTACTACGGGCTGGGCGGCTCCCCCAACAAGGCCATGGGCA
GCAACTACTTT
GTGAGTGCTTGGCTTTCTTCAGCATGTACTGTTTGTGGTCCTGCGTGGCTGCCTGTTGAGCCTGCTGTCCAGCTGGGGCGGTACCTGAATGCACGACAGCAGCAGTTGT
GCATTCATCCACGGCATACAGCCCTCACTCCAAGACGCTGCCTTCTTCCCTGCTGCTCGGCTGCGTGCCGACTGTTGTTCCCCTGCTGCCCCTCCCCTCCCCTTGCGCAGCTGTGGATCA
TCCTGGGCATCTCCTTCCTGGCTGTGCTGTCCAAGCTGACGGGCGCCCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGCTGCGCTCGCTGTCCCCACCGCCGCCCTGGCGCGGCCCCGGCCCGCCCTGCCCTCTCGGAAGGCGGTGAGGGCCCGGGCAGGCGGTCCAAACGGTCCCCTGCGCGAGTTCCGT
GAGGACACGGGCGAGGTGAGCACCAGCGGCGGCGAGAGCGGCGGCGGCGCGAGCGGCAGCGGCGCCGCGCCCGAGAAGCAGCAGGGCCAGCCCAAGTACATCTACGCCGACGAACAGCCG
CCCCCTCGCGACACGATGAGCCCAGAGATGAAGGAGCGGCTGCGCCGCGAGTACTACGGGCTGGGCGGCTCCCCCAACAAGGCCATGGGCAGCAACTACTTTCTGTGGATCATCCTGGGC
ATCTCCTTCCTGGCTGTGCTGTCCAAGCTGACGGGCGCCCTCTGA

Retrieve as FASTA