Entry information : CsorCcP01
Entry ID 15184
Creation 2018-04-27 (Christophe Dunand)
Last sequence changes 2018-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2018-04-27 (Christophe Dunand)
Peroxidase information: CsorCcP01
Name CsorCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Viridiplantae Chlorophyta Trebouxiophyceae Chlorellaceae Chlorella
Organism Chlorella sorokiniana    [TaxId: 3076 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsorCcP01
start..stop
S start..stop
CsubCcP01 422 4e-149 16..338 32..350
NocCcP02 404 5e-143 77..340 9..272
CspCcP06 398 2e-140 36..335 2..295
CspCcP03 395 5e-139 77..340 52..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 164116..164208 93 N° 2 164493..164558 66 N° 3 164797..164877 81 N° 4 165163..165202 40
N° 5 165330..165438 109 N° 6 165710..165788 79 N° 7 166297..166363 67 N° 8 166659..166782 124
N° 9 167063..167163 101 N° 10 167456..167538 83 N° 11 167762..167799 38 N° 12 167983..167997 15
N° 13 168196..168250 55 N° 14 168401..168481 81  
join(164116..164208,164493..164558,164797..164877,165163..165202,165330..165438, 165710..165788,166297..166363,166659..166782,167063..167163,167456..167538,16776 2..167799,167983..167997,168196..168250,168401..168481)


exon

Literature and cross-references CsorCcP01
Protein sequence: CsorCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343
PWM (Da):   %s   37459.59  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLRQALRTATRAAGQAARGFATQAGEQGKGGSSLPLFLGLAAAGGGLYYAKEQGMLDSILGAVPGTAGSAAASFKPDYNAVRKAIEDLLESNEDYDDGSYGPVLVRLAWHTSGTYDKSTNTGGSNGATMRFLPESNWGANAGLAVARDLLEPVKQFPWISYSDLWTLAGATAIEAMGGPHIPWRPGRSDYAPDQFVALPDGRLPDGDKDAKHIRDIFYRMGFNDQEIVALCGAHTLGRCHSDRSGFLGPWTAPTTFSNLYYVELTENKWHKKKWKGPLYEDKSGQLMMLNTDMWLLWDKKFKPFTQEYAKNEEFFNDFAAAFSKLLELGVPFPEGAQTV*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCGGCAGGCGCTGCGCACTGCCACCCGGGCGGCCGGCCAGGCCGCCCGTGGATTTGCCACGCAGGCCGGGGAGCAGGGCAAGGGCGGGGTGAGTGTCTCCGTCAGAACCCCTCGC
GGCTGGCGCGCGCCTGGTCGGTTTCCCGCCTGCTCGGCGCTCGGGGGCGCGCCACGGCGTGATCGCGGCCGCTGCCAGCAACCCTGGGCCGTCCTGCCCCCCTCCGCCGGCGGCGCTGAC
GCTGCTCCACGCGACCGTTTGTCACGGGCCGTGCCGCCTCAACGCCAGCTCTCCCGGCCTGCGGATCCTGCTCATGCCCGGCTGATGCAGCCCACAAACCCAGACCACCCGCCCTGCCCT
GCCGCCCCGCCTTGCAGAGCTCCCTGCCGCTGTTCCTGGGCCTGGCTGCCGCCGGCGGCGGCCTGTACTATGCCAAGGAGCAGGTGTGGCGGGTGCATTGTTGATTGCTTTGCAGCCCCC
CATGGCTCGATTCGGAAACTGTTACAGCTTGCCTGCTCAGCTGTGCCATAGCCGCTGCACTGCGGCGCCTGTGCAGGCGGCTGGCCGGCTGCTCAATGCGCAGATTTGCGCCCTCATCCT
GCCGCCGCCTGCCCAGCTGCCGCCGCAGCTCGTCTTGCTCACTGCACTGCCTGTGCTGCCATCTGTACCCGCTTGCCACAGGGCATGCTGGACTCGATCCTGGGTGCTGTGCCTGGTACC
GCCGGCTCAGCCGCCGCCTCCTTCAAGCCCGATTACAATGCG
GTGCGCCTCAAAGCGCATTTGCGATTTGCTGTTTGTTGTCTGTTGCTCGCAAAGCTTACCTGCCTGTGACCGCCTCAT
TCAAGCCCGACTACAATGCGGTGCGCGGCTGGGTTCACGTGCACACATGCGGCGCCAAGCACACAGTGCTGGGCGTGGCACTGCTGCTGTCAGCGTGCACGTTGGCTGCATGGCTGCTGT
GCTGCTGTGGGCTCTTGCCTTGCTGCCTGATTGGCACCTGCACCGGTCATGAGCCTTTGCTGTGCTGTGCGCACCCTGTGTGTGCAGGTGCGCAAGGCGATCGAGGACCTGCTGGAAAGC
AACGAGG
GTGAGCTGGAACTGTTATTTGCCTCTGGGTTCTTGAGCCTGCAAATGCACCCCAGTACTCCATGCTCGCTGCCCACTTGCCTGCCCCCCGATCCGCCCCTACCCTCCCTCCTC
AACTCAACCCTCAGACTACGATGACGGCAGCTACGGCCCTGTCCTGGTGCGCCTGGCCTGGCACACCAGCGGCACCTACGACAAGAGCACAAACACGGGCGGCTCAAACGGCGCCACCAT
GCG
GTGCGGGCGGTTCGGGTGTGCTGTGCCCGTGTGTTTTCCACCTGGCGTCCTGTTATAACCTGTCCACGGCCCTGCTGCCGCGGTAGACTGCTGCGCACTGCTGCTTGCGACAGTGGT
GTTGTCTGCACCCGTTGACGTCATCACCCGCACTCTCCTCTCTACCGCACCCTCCCAGCTTCCTGCCCAAGTCCATCTGGGGCACAAGTCTGCGTAAGATACAGCTCCTCACCCTTGTTC
TCTGCCCTGTCCCCCCTGCCCCACCCCCTTGCAGCTTCCTGCCCGAGTCCAACTGGGGCGCCAATGCCGGCCTGGCGGTGGCCCGAGACCTGCTGGAGCCGGTGAAGCAGAAGGTGAGAG
ATGCTGAATGAGTTGAATGAGTGAATGGTTGACGGTTGAACTGGCGCGATTGATTCAGGGGTCGGGCACGACCTGCTGGAGCCGGTGAAGCAGAAGGTGGGAGATGCTGAATGAGTTGAA
TGCAACTACAAATGTTTGATAGTTGCATCGGCGCAATCGAATACGGGGTGCAGGCGCGACCTGCGACATCAGCGAATGATTGTACCGGTTGGTAGATGCATCAGCGGTATCGATCGAGGG
AGGAGCCCAGCCTGCTGTTTTGTGCAATGTGGCCTTGCATGGATCTTGGAATACAGGAGGAACGCAGTTGGCGCTCTTGGTGCATGGCTCTTGCCTGCTGTGTCCTGCATGTGCCCTCCA
AGCTTTGAACAGGCTCCACCCTGTCCTCTTCCCCGCAGTTCCCCTGGATCTCATACAGCGGGGTGTGAAGTGTGCCCCCTCGCTCCCTCCACTCCACTCATCGCCACCAATCCCGCACCT
CCTCCCCCACTTCCCCCGCAGTTCCCCTGGATCTCCTACAGCGACCTGTGGACCCTGGCGGGCGCCACCGCCATTGAGGCCATGGGCGGTGAGCGGGCTGGCCGGATGGAGGAGCAGGGC
GGGTGGGGTGCGAGCGGAGGGCCGGCGCGGGCAGACGGCAGGCCGCGCTGGTGGGGGGTGCCTGGCTTTGCAACATGCTCGTGGCACATCAAGTGGTCCTGATCGCCCGCACTGCCCGCC
CCCATGCCCTGCACACTTCCCCAGGCGCGCACACCCCCTAGCGCCCCGGCCGCTCGCTCCTCTTTGCACCCCCCAGAAGCCTGTGAATGATGATAACAGTCATTCTTCCTGTCCCTCCCC
CACCCCACAACATGCCCCATCAGGCCCCCACATCCCCTGGCGCCCCGGCCGCTCCGACTATGCTCCCGACCAGTTTGTGGCGCTGCCTGATGGCCGCCTGCCCGACGGCGACAAGGACGC
CAAGCACATCCGGGACATCTTCTACCG
GTGGGCTGAAGTGCATAGTTTCATGCATATACGCATCAATGCAGTAACCTTGCCTGCAATGTGCAACGCTACTTGCCCCGCCCCGCAGCTTCA
CCCAGATTGTCCATAGGTTGTTGCCTGTGCGCCATTGCTTGTTGCGCACCCTCCCTGCCTGCCCTGCGTTGCCTCCTCCCCTCCCTCTGACAGGATGGGCTTCAACGACCAGGAGATTAT
GGCGACTGAACGGAGCCTTTTTATCTACGTGTACTTGTTACTCTTTTCCTCGCTTCCCCACCAACAGGATGGGCTTCAACGACCAGGAGATTGTGGCGCTGTGCGGCGCGCACACGCTGG
GCCGCTGCCACTCCGACCGCTCTGGATTCCTGGGGCCCTGGACCAACG
GCGAGTGCGGGGGGAGGTGGAGAGCGGGGCTGACTTCTGGCTTGTGCTTGTCTGCTTACGCTCCAGTCTAAG
CGTCCAGGAGCAACCTCTACTTTGTGGAGCTGCATCCCACATTGCAGTTCTTTGACTGCTTGATTCACCATTATGCTGCCACTGCAATGCCCTCCCTCCCTCCCAACCACCTGCAGCCCC
CACCACCTTCTCCAACCTTGTACTCAGTGGAGCTGCTTTTTACTGCCCCACTGACCGCCTCAATGCTTTTTCCTTCCCATTTATTCCTTGGTTACTGCAGCCCCCACCACCTTCTCCAAC
CTGTACTACGTGGAGCTGACGGAGAACAAGTGGCACAAGAAGAAGTGGAAGGGGCCCCTGCAG
GTGGGAGGGGGCTGGGTCGGTGTGTTTGTGTGCTGGTGCGCCTGTTTGGCAGCTTGC
AGATCAAGGCACAAGCAGAAGTGGAAGGGGCCCCTGCAGGTAGGAGGGGGCTGGGGCGCAGGGCAGGGGCGGGACGCCGGGTCTCTTGCGCAGAGCCGAGGGTACCGCACCCTGTGCTAT
GCAGCTAGTAAGAGAGTCATTCCCTTGTGCTCTGCCCTCATTGCAGTATGAGGACAAGAGCGGCCAGCTGATGATGCTCAACACGTGAGGGCGGGGCTGCTGTTTGTTCGGGACGAGAAC
AAGGATAGGATGTGCAGCCCAGCGCAATATGCTTGAGCTGGCCAGTGGTGCGGTGCAGTCAAGTGCCCCTGCTGCCGTGGGTGGAGGCGACCCTGTGCTCCTGGGCAGCTGCTCACTCTG
GCTGCCTGCCTCTTTCGTCCGTTGCAGGGACATGTGGCTGCTGTGAGTCCGGCTGGAGGCTGCAGATGACTTGGGGATGTTGTCTGCCAGCCGGCAGCGGGTTGCTGGCAGGGCAGCGCT
TGCACGGCGTGCCTGCTCAGACCATGCCGCTTGGAGCCACGTGTCTGCCCTGCTCCCTGCTCCTCCGCACCCAATTGCACTCAATGCCCCTGCGCCCCCATGCATCTGCCCCACTTGCAG

GTGGGACAAGAAGTTCAAGCCTTTCACGCAGGAATACGCCAAGAACGAGGAGAAG
GTGGGTGCTTGCTACTTTTGAGAGAAATGGGGTGGGGGCAGGCTCCGTGGCCCGAAGGCGGACAC
CGAAGCGGCGCTGGAGGATGTGGGCGGTGTGCAATCAACAGGCAGCTGCAACAGAGTCTCCTTTCCACAACTCCTCTGCCCGCAGTTCTTTAACGACTTTGCCGCCGCCTTTTCCAAGCT
GCTGGAGCTGGGGGTGCCCTTCCCCGAAGGCGCGCAGACCGTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCGGCAGGCGCTGCGCACTGCCACCCGGGCGGCCGGCCAGGCCGCCCGTGGATTTGCCACGCAGGCCGGGGAGCAGGGCAAGGGCGGGAGCTCCCTGCCGCTGTTCCTGGGCCTG
GCTGCCGCCGGCGGCGGCCTGTACTATGCCAAGGAGCAG
GGCATGCTGGACTCGATCCTGGGTGCTGTGCCTGGTACCGCCGGCTCAGCCGCCGCCTCCTTCAAGCCCGATTACAATGCG
GTGCGCAAGGCGATCGAGGACCTGCTGGAAAGCAACGAGGACTACGATGACGGCAGCTACGGCCCTGTCCTGGTGCGCCTGGCCTGGCACACCAGCGGCACCTACGACAAGAGCACAAAC
ACGGGCGGCTCAAACGGCGCCACCATGCG
CTTCCTGCCCGAGTCCAACTGGGGCGCCAATGCCGGCCTGGCGGTGGCCCGAGACCTGCTGGAGCCGGTGAAGCAGAAGTTCCCCTGGATC
TCCTACAGCGACCTGTGGACCCTGGCGGGCGCCACCGCCATTGAGGCCATGGGCG
GCCCCCACATCCCCTGGCGCCCCGGCCGCTCCGACTATGCTCCCGACCAGTTTGTGGCGCTGCCT
GATGGCCGCCTGCCCGACGGCGACAAGGACGCCAAGCACATCCGGGACATCTTCTACCG
GATGGGCTTCAACGACCAGGAGATTGTGGCGCTGTGCGGCGCGCACACGCTGGGCCGCTGC
CACTCCGACCGCTCTGGATTCCTGGGGCCCTGGACCAACG
CCCCCACCACCTTCTCCAACCTGTACTACGTGGAGCTGACGGAGAACAAGTGGCACAAGAAGAAGTGGAAGGGGCCCCTG
CAG
TATGAGGACAAGAGCGGCCAGCTGATGATGCTCAACACGGACATGTGGCTGCTGTGGGACAAGAAGTTCAAGCCTTTCACGCAGGAATACGCCAAGAACGAGGAGAAGTTCTTTAAC
GACTTTGCCGCCGCCTTTTCCAAGCTGCTGGAGCTGGGGGTGCCCTTCCCCGAAGGCGCGCAGACCGTGTGA

Retrieve as FASTA