Entry information : NnPrx64
Entry ID 16198
Creation 2020-03-11 (Christophe Dunand)
Last sequence changes 2020-03-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: NnPrx64
Name NnPrx64
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Nelumbonaceae Nelumbo
Organism Nelumbo nucifera (sacred lotus)    [TaxId: 4432 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value NnPrx64
start..stop
S start..stop
VvPrx64 536 0 13..313 19..319
AfpPrx24 532 0 1..316 1..316
AcoPrx43 530 0 1..316 1..316
CsPrx27 530 0 1..316 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 113..316 204 N° 2 431..619 189 N° 3 819..981 163 N° 4 1084..1478 395
join(113..316,431..619,819..981,1084..1478)


exon

Literature and cross-references NnPrx64
Cluster/Prediction ref. Genebank:   104603652
Protein sequence: NnPrx64
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316
PWM (Da):   %s   33736.98  
PI (pH):   %s   8.64
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAIVALLCTLFVFSVSSPGDALSLDYYDKTCPQAESTITNVVKKAMTNDNTVPAALLRMHFHDCFIRGCDGSVLLKSVGNNQAEKDGPPNISLHAFYVIDNAKKAIESVCPGVVSCADILALAARDAVALSGGPTWEVPKGRKDGRVSKASETRQLPAPTFNISQLQQSFSQRGLSMADLVALSGGHTLGFAHCSSFQNRIHNFSPNSDIDPSMNQAFATSLRIVCPAHNKVKNAGSTMDSSVTTFDNTYYKLLLQGKSLFSSDQALLTTSKTKSLVSKFASSQADFNKAFVKSMIKMSSLAGGQEVRLDCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCCATTGTTGCACTTCTGTGCACACTCTTCGTCTTCTCAGTTTCTTCTCCTGGGGATGCCCTCAGCTTAGACTACTACGACAAAACATGTCCACAAGCTGAGTCAACCATCACC
AATGTTGTGAAGAAGGCGATGACGAATGATAATACAGTGCCGGCAGCACTACTTCGGATGCATTTCCATGATTGCTTCATAAGG
GTAATCTTCTTCTTATTTATTTATTTTTTCAAATAA
TATGTATTTTAATCAGCCAGCAGCCCAGAACTACTTCGTCCAGTTGAATTGAATTAATTCCTGTTTTGTTTTTTGAAGGGTTGCGATGGCTCGGTGCTGTTGAAATCTGTAGGAAACAAC
CAAGCTGAAAAGGATGGCCCTCCTAACATTTCCTTGCATGCATTTTATGTCATTGACAATGCAAAGAAAGCAATAGAGTCGGTGTGCCCCGGTGTCGTCTCCTGTGCAGATATCTTGGCT
CTAGCTGCAAGAGATGCAGTTGCTCTA
GTAAGTCCAAACACCACACTGCTCGCTCTTTAATTGTTTTCTTCATTGAGGTTGGACTGAAGAGTGAAACTTGAAACTGATTCTGTGTGGAAT
GCAGACTACACATTGCTTATATATATATATATGTGTGTGTGTATATATTCATTTCATAGAGTAGCAGTGATGGTTTAATGCATGGTATTTAATATTTCTTTCTCAGTCTGGAGGTCCTAC
TTGGGAAGTGCCCAAAGGAAGAAAAGATGGAAGAGTTTCAAAAGCCAGTGAAACCAGACAATTGCCAGCTCCCACCTTCAACATATCTCAATTGCAGCAAAGCTTCTCTCAGAGAGGTTT
ATCCATGGCAGACCTGGTCGCTCTTTCAG
GTAATTTAATTACATATGTTGTACCGGTCAATCAGTGGTTAAATGGGGTTGGACCAACAGGTTCCCTGCAGGCTAGAGTAACTATTTGACA
ATAAATTGCAGGAGGTCACACCCTTGGATTCGCTCATTGTTCATCCTTCCAGAACAGAATCCACAACTTCAGCCCCAATAGTGATATAGATCCTTCGATGAACCAGGCCTTCGCGACGAG
TCTGAGAATTGTCTGTCCCGCACACAACAAGGTAAAGAATGCTGGTTCTACCATGGATTCTAGTGTCACCACATTCGACAACACATATTACAAGCTACTCCTCCAGGGGAAGAGTCTATT
CTCTTCGGACCAAGCTTTGCTCACTACCTCAAAAACCAAATCGCTTGTGTCCAAGTTTGCTAGCTCCCAGGCGGACTTCAATAAGGCTTTTGTCAAGTCTATGATCAAGATGAGTAGCCT
CGCTGGTGGACAAGAGGTTAGGTTGGATTGCAGAGTGGTTAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCCATTGTTGCACTTCTGTGCACACTCTTCGTCTTCTCAGTTTCTTCTCCTGGGGATGCCCTCAGCTTAGACTACTACGACAAAACATGTCCACAAGCTGAGTCAACCATCACC
AATGTTGTGAAGAAGGCGATGACGAATGATAATACAGTGCCGGCAGCACTACTTCGGATGCATTTCCATGATTGCTTCATAAGG
GGTTGCGATGGCTCGGTGCTGTTGAAATCTGTAGGA
AACAACCAAGCTGAAAAGGATGGCCCTCCTAACATTTCCTTGCATGCATTTTATGTCATTGACAATGCAAAGAAAGCAATAGAGTCGGTGTGCCCCGGTGTCGTCTCCTGTGCAGATATC
TTGGCTCTAGCTGCAAGAGATGCAGTTGCTCTA
TCTGGAGGTCCTACTTGGGAAGTGCCCAAAGGAAGAAAAGATGGAAGAGTTTCAAAAGCCAGTGAAACCAGACAATTGCCAGCTCCC
ACCTTCAACATATCTCAATTGCAGCAAAGCTTCTCTCAGAGAGGTTTATCCATGGCAGACCTGGTCGCTCTTTCAG
GAGGTCACACCCTTGGATTCGCTCATTGTTCATCCTTCCAGAAC
AGAATCCACAACTTCAGCCCCAATAGTGATATAGATCCTTCGATGAACCAGGCCTTCGCGACGAGTCTGAGAATTGTCTGTCCCGCACACAACAAGGTAAAGAATGCTGGTTCTACCATG
GATTCTAGTGTCACCACATTCGACAACACATATTACAAGCTACTCCTCCAGGGGAAGAGTCTATTCTCTTCGGACCAAGCTTTGCTCACTACCTCAAAAACCAAATCGCTTGTGTCCAAG
TTTGCTAGCTCCCAGGCGGACTTCAATAAGGCTTTTGTCAAGTCTATGATCAAGATGAGTAGCCTCGCTGGTGGACAAGAGGTTAGGTTGGATTGCAGAGTGGTTAATTAG

Retrieve as FASTA