Entry information : MePrx03 ( cassava4.1_011662m)
Entry ID 1662
Creation 2005-06-17 (Qiang Li)
Last sequence changes 2016-02-24 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-24 (Achraf Jemmat)
Peroxidase information: MePrx03 ( cassava4.1_011662m)
Name (synonym) MePrx03 ( cassava4.1_011662m)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue types Roots
Tubers
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx03
start..stop
S start..stop
MePrx133 560 0 23..326 19..322
RcPrx06 557 0 1..326 1..327
CsPrx28 526 0 1..324 1..323
CclPrx37 525 0 1..324 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45759..45974 216 N° 2 46047..46244 198 N° 3 46519..46684 166 N° 4 46857..47314 458
join(45759..45974,46047..46244,46519..46684,46857..47314)


exon

Literature and cross-references MePrx03 ( cassava4.1_011662m)
Literature REFERENCE 1 Reilly,K., Bernal,D., Cortes,D., Gomez-Vasquez,R., Beeching,J.R. and Tohme,J. Knowledge and tools for the modulation of post-harvest physiological deterioration in cassava Unpublished.

REFERENCE 2 Lopez,C., Jorge,V., Piegu,B., Mba,C., Cortes,D., Restrepo,S., Soto ,M., Laudie,M., Berger,C., Cooke,R., Delseny,M., Tohme,J. and Verdier,V. A unigene catalogue of 5700 expressed genes in cassava. Plant Mol. Biol. 56 (4), 541-554 (2004).
Protein ref. UniProtKB:   Q52QY2
DNA ref. Phytozome 11:   scaffold03486 (45759..47340)
mRNA ref. GenBank:   AY973612
EST ref. GenBank:   DN740367 [5' end]
Protein sequence: MePrx03 ( cassava4.1_011662m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346 (320)
PWM (Da):   %s   37732.16 (34952.7)  
PI (pH):   %s   8.39 (8.39) Peptide Signal:   %s   cut: 26 range:26-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MESKMSFLVLSNFLLLSLLLPTSSAQLSKNFYSGTCPNVESIVRSEVQKKFQQTFVTVPATLRLFAHDCFVRGCDASLLLSSPSNNAEKDHPDNLSLAGDGFDTVIKAKAAVDSVSQCRNKVSCADILALATRDVVSLAGGPFYEVELGRRDGRISTKASVQHKLPSADFNLDQLNSMFASLGLTQTDMIALSGAHTLGFSHCNRFSKRIYNFSPRNKIDPTLNLQYALQLREMCPVKVDPRIAIDMDPTTPQKFDNAYYGNLIQGKGLFTADQILFSDSRSRPTVNLFASNNAAFQNAFVSAMTNLGRVGVLTGNKGEIRTDCTRXQLEESRIALFFFLGSFLG

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns), 1 mRNA and 2 ESTs (DR086520.1). join(45759..45974,46047..46244,46519..46684,46857..47340).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAAGCAAAATGAGCTTCCTGGTTCTATCTAATTTTCTTCTTCTCTCTCTCCTTCTTCCTACTTCTTCTGCTCAACTTAGCAAGAACTTCTACAGCGGAACATGCCCTAATGTTGAA
TCCATAGTCCGTTCTGAAGTCCAGAAGAAGTTCCAGCAAACTTTTGTCACTGTTCCTGCAACTCTTCGCCTCTTCGCCCATGACTGCTTTGTCAGG
GTTAGTGTTTTATTGTTTCTTCTT
AAGATTTGATTTTCTTTTAGTTTGTAATTATTTATTTCTTGTTAATAGGGATGTGATGCTTCGTTGTTGCTATCTTCGCCGAGTAACAATGCGGAGAAAGACCACCCGGATAATCTTTCG
CTCGCCGGAGATGGTTTTGACACGGTGATCAAGGCAAAGGCTGCCGTTGATAGTGTTTCTCAATGCAGGAACAAAGTTTCATGTGCTGATATTCTGGCTCTTGCTACTAGAGATGTTGTA
TCTTTG
GTAAGCAAGGTTTTTTCCCTTTATTTTCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTGATGAGTTTGAAAATGGGTTGGATATTTTGAGT
ATTCTATTTAATTGAATTTTATTGAAATTCATATAATATATATATGGTAGGAAATACTTTATCCTCTTTAGTAGGTATATTTGGTATAATGAATAAATTTTACAAGTATAATAAAGTTGT
GGAGCATGTGCATGATTAATTAAATGAAATGGAAATGCAGGCAGGAGGACCATTTTATGAAGTGGAACTAGGGAGGCGTGACGGGAGAATATCAACAAAGGCAAGTGTTCAACACAAGCT
GCCAAGTGCTGACTTCAATTTAGACCAGCTCAATTCTATGTTCGCTTCACTTGGCCTTACCCAAACTGACATGATTGCTTTATCAG
GTACCTCTTTTCAACTTTTTCTTTTCTAAAAAGA
AATATAATTAATACATTGCCACTTGATTCTGCAAGGTACACGTTGGCTAATACATGTATTTTGAAAATACTGTATAATTTTCCACGTATGAAATTACCTTCAATTTCTAACAATAATATG
TGAAATTTTTACATATAGGTGCACACACACTTGGATTTTCTCATTGCAACAGATTCTCCAAAAGGATATACAACTTCAGTCCAAGAAACAAGATTGATCCAACACTCAATCTTCAATATG
CACTTCAGCTGAGGGAAATGTGCCCTGTGAAAGTAGACCCAAGAATTGCCATTGACATGGACCCAACCACACCTCAGAAATTTGACAATGCTTACTATGGAAACCTCATACAAGGAAAAG
GGTTGTTCACTGCAGACCAGATCCTGTTTTCTGACTCTAGATCAAGACCCACTGTCAACCTTTTTGCTTCTAACAATGCAGCTTTTCAGAATGCTTTTGTCTCTGCCATGACAAACCTTG
GTAGAGTTGGTGTCTTGACTGGAAATAAAGGTGAAATCAGAACAGATTGTACTCGTATNCAACTAGAAGAGAGTAGAATTGCTTTATTTTTTTTTTTGGGTTCATTTTTAGGGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAAGCAAAATGAGCTTCCTGGTTCTATCTAATTTTCTTCTTCTCTCTCTCCTTCTTCCTACTTCTTCTGCTCAACTTAGCAAGAACTTCTACAGCGGAACATGCCCTAATGTTGAA
TCCATAGTCCGTTCTGAAGTCCAGAAGAAGTTCCAGCAAACTTTTGTCACTGTTCCTGCAACTCTTCGCCTCTTCGCCCATGACTGCTTTGTCAGG
GGATGTGATGCTTCGTTGTTGCTA
TCTTCGCCGAGTAACAATGCGGAGAAAGACCACCCGGATAATCTTTCGCTCGCCGGAGATGGTTTTGACACGGTGATCAAGGCAAAGGCTGCCGTTGATAGTGTTTCTCAATGCAGGAAC
AAAGTTTCATGTGCTGATATTCTGGCTCTTGCTACTAGAGATGTTGTATCTTTG
GCAGGAGGACCATTTTATGAAGTGGAACTAGGGAGGCGTGACGGGAGAATATCAACAAAGGCAAGT
GTTCAACACAAGCTGCCAAGTGCTGACTTCAATTTAGACCAGCTCAATTCTATGTTCGCTTCACTTGGCCTTACCCAAACTGACATGATTGCTTTATCAG
GTGCACACACACTTGGATTT
TCTCATTGCAACAGATTCTCCAAAAGGATATACAACTTCAGTCCAAGAAACAAGATTGATCCAACACTCAATCTTCAATATGCACTTCAGCTGAGGGAAATGTGCCCTGTGAAAGTAGAC
CCAAGAATTGCCATTGACATGGACCCAACCACACCTCAGAAATTTGACAATGCTTACTATGGAAACCTCATACAAGGAAAAGGGTTGTTCACTGCAGACCAGATCCTGTTTTCTGACTCT
AGATCAAGACCCACTGTCAACCTTTTTGCTTCTAACAATGCAGCTTTTCAGAATGCTTTTGTCTCTGCCATGACAAACCTTGGTAGAGTTGGTGTCTTGACTGGAAATAAAGGTGAAATC
AGAACAGATTGTACTCGTATNCAACTAGAAGAGAGTAGAATTGCTTTATTTTTTTTTTTGGGTTCATTTTTAGGGTAG

Retrieve as FASTA