Entry information : MePrx06 (cassava4.1_011604m)
Entry ID 1665
Creation 2005-06-17 (Christophe Dunand)
Last sequence changes 2011-07-01 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx06 (cassava4.1_011604m)
Name (synonym) MePrx06 (cassava4.1_011604m)
Class Class III peroxidase    [Orthogroup: Prx031]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx06
start..stop
S start..stop
PtPrx08 571 0 24..330 25..331
PtrePrx03 561 0 24..330 24..330
VvPrx38 531 0 26..329 25..328
CsPrx04 526 0 15..330 14..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10052..10133 82 N° 2 9642..9790 149 N° 3 9374..9562 189 N° 4 9060..9225 166
N° 5 8577..8983 407  
complement(join(8577..8983,9060..9225,9374..9562,9642..9790,10052..10133))


exon

Literature and cross-references MePrx06 (cassava4.1_011604m)
Literature Lopez,C., Jorge,V., Piegu,B., Mba,C., Cortes,D., Restrepo,S., Soto ,M., Laudie,M., Berger,C., Cooke,R., Delseny,M., Tohme,J. and Verdier,V. A unigene catalogue of 5700 expressed genes in cassava. Plant Mol. Biol. 56 (4), 541-554 (2004).
DNA ref. Phytozome 12:   scaffold08959 (10133..8577)
Protein sequence: MePrx06 (cassava4.1_011604m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (300)
PWM (Da):   %s   36935.53 (33396.6)  
PI (pH):   %s   5.25 (4.97) Peptide Signal:   %s   cut: 31 range:31-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPTNITQRGTSTFLFFLLLPLLLQFYPGKSELQLNYYAQSCPRAEEIIKEQVINLYKKHGNTAVSWVRNLFHDCGVKSCDASLLLETANGIESEKASQRSFGMRNFKYVNTIKDAVEAECPLTVSCADIVALSARDGIVMLGGPRTEMKTGRRDSKESYAAVLENFLPNHNDSMSLVLSRFQSIGIDTEGAVALLGGHSVGRVHCVNLVQRLYPTVDPSLDPEYAEYLKGRCPTPDPDPEEVLYARNDRETPMILDNMYYKNILKHKGLLLVDQQLASDPITSPFVEKMAGDNGYFLDQFSRAVVLLSENNPLTDDQGEIRKDCRYVNTN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCACCAACATTACCCAACGTGGAACTTCAACCTTCCTCTTCTTTCTGTTATTGCCGTTGCTCTTGCAATTTTATCCTGGTAACGTTCATAGCATATACTTGTACAAGAAATTCTAG
CTTCGTTAGCTAGCGCATCATTCGATTAATGCATTTAAACATTTCCAGTTATTTGTTATGAAATTATTCACCTCTGCAGTGAAGAAAAGAAAATATCATATGTTATATTTTATTAGCTAT
TACTCGCCGTTAGGCTTTATTAAAATGAAATTTTGATTATTAGTGACGATATATGTTCACCGGTGTGCTGAATAATATTTCATTTGGTGACTGTTGAGCTCAGGTAAAAGTGAGCTCCAA
CTAAACTATTATGCACAAAGTTGCCCAAGAGCTGAAGAGATCATCAAAGAGCAAGTCATTAATCTGTACAAGAAACATGGAAATACGGCAGTTTCCTGGGTTAGGAATCTCTTCCATGAT
TGTGGGGTGAAG
GTATTATATTATTTTGGTTAATTAATTAATTGTTAATTATCTTTCATAGTTGGTTAATTACCTTGTTAATTTGATTCAGTCGTGTGATGCATCGCTGTTGTTGGAGAC
GGCGAACGGAATTGAATCGGAGAAAGCATCACAGAGGAGCTTTGGAATGAGAAATTTTAAGTACGTGAACACAATCAAAGATGCAGTTGAAGCTGAATGCCCTTTGACCGTCTCTTGTGC
TGATATTGTTGCTCTTTCTGCAAGAGATGGTATTGTCATG
GTACGTCTTCTTCATAGTTTAAAACATATTTCTATGCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCATAG
TTTCAAGAATTCAAAAGGCAAAGAAATAATTTGATAACAAGGAATTTATATTGGGATGAAATCTACAGTTAGGGGGACCAAGAACAGAAATGAAAACAGGGAGAAGGGACAGCAAAGAGA
GCTATGCAGCGGTGCTAGAAAACTTCCTCCCCAATCACAACGACAGCATGTCATTAGTGCTTTCTCGCTTTCAATCCATTGGCATTGACACTGAAGGAGCTGTTGCTCTTTTAG
GTATGT
CATCAAACACTTATGAAAAACTACATACTGCCCATCAATGTTCTAATCTAATATGTGTAATCTTGTTCAGGAGGTCACTCGGTTGGTAGAGTTCACTGTGTGAACTTAGTACAGAGACTC
TACCCTACAGTTGACCCGAGTTTGGACCCTGAGTATGCAGAGTACCTCAAAGGAAGGTGCCCAACTCCAGACCCGGACCCAGAAGAAGTTCTGTATGCAAGAAATGACAGAGAAACACCC
ATGATTCTTGATAATATGTACTACAAGAACATATTGAAGCACAAGGGATTGCTTTTAGTGGATCAACAATTGGCTTCTGATCCCATTACTTCTCCATTTGTGGAAAAAATGGCTGGCGAT
AATGGATACTTCCTTGATCAGTTCTCTAGAGCTGTGGTGTTGTTGTCGGAGAATAATCCTCTTACTGATGATCAAGGAGAGATAAGAAAGGATTGCCGCTATGTGAATACCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCACCAACATTACCCAACGTGGAACTTCAACCTTCCTCTTCTTTCTGTTATTGCCGTTGCTCTTGCAATTTTATCCTGGTAAAAGTGAGCTCCAACTAAACTATTATGCACAAAGT
TGCCCAAGAGCTGAAGAGATCATCAAAGAGCAAGTCATTAATCTGTACAAGAAACATGGAAATACGGCAGTTTCCTGGGTTAGGAATCTCTTCCATGATTGTGGGGTGAAG
TCGTGTGAT
GCATCGCTGTTGTTGGAGACGGCGAACGGAATTGAATCGGAGAAAGCATCACAGAGGAGCTTTGGAATGAGAAATTTTAAGTACGTGAACACAATCAAAGATGCAGTTGAAGCTGAATGC
CCTTTGACCGTCTCTTGTGCTGATATTGTTGCTCTTTCTGCAAGAGATGGTATTGTCATG
TTAGGGGGACCAAGAACAGAAATGAAAACAGGGAGAAGGGACAGCAAAGAGAGCTATGCA
GCGGTGCTAGAAAACTTCCTCCCCAATCACAACGACAGCATGTCATTAGTGCTTTCTCGCTTTCAATCCATTGGCATTGACACTGAAGGAGCTGTTGCTCTTTTAG
GAGGTCACTCGGTT
GGTAGAGTTCACTGTGTGAACTTAGTACAGAGACTCTACCCTACAGTTGACCCGAGTTTGGACCCTGAGTATGCAGAGTACCTCAAAGGAAGGTGCCCAACTCCAGACCCGGACCCAGAA
GAAGTTCTGTATGCAAGAAATGACAGAGAAACACCCATGATTCTTGATAATATGTACTACAAGAACATATTGAAGCACAAGGGATTGCTTTTAGTGGATCAACAATTGGCTTCTGATCCC
ATTACTTCTCCATTTGTGGAAAAAATGGCTGGCGATAATGGATACTTCCTTGATCAGTTCTCTAGAGCTGTGGTGTTGTTGTCGGAGAATAATCCTCTTACTGATGATCAAGGAGAGATA
AGAAAGGATTGCCGCTATGTGAATACCAATTAG

Retrieve as FASTA