Entry information : PpaPrx33 (PP00037G01430)
Entry ID 1680
Creation 2008-08-05 (Christophe Dunand)
Last sequence changes 2011-01-25 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx33 (PP00037G01430)
Name (synonym) PpaPrx33 (PP00037G01430)
Class Class III peroxidase    [Orthogroup: Prx051]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx33
start..stop
S start..stop
PpaPrx07 510 0 10..333 1..324
PpaPrx53 320 6e-109 17..333 12..335
PpaPrx13 320 6e-109 17..333 12..335
PpaPrx43 313 3e-106 17..333 12..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1864753..1865007 255 N° 2 1865241..1865420 180 N° 3 1865796..1866362 567  
join(1864753..1865007,1865241..1865420,1865796..1866362)


exon

Literature and cross-references PpaPrx33 (PP00037G01430)
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008)
DNA ref. Phytozome 12:   scaffold_37 (1864753..1866362)
Protein sequence: PpaPrx33 (PP00037G01430)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (296)
PWM (Da):   %s   35442.18 (31416.1)  
PI (pH):   %s   4.41 (4.22) Peptide Signal:   %s   cut: 38 range:38-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSEVNPSKRMPNHRRGLATALLTIAFVFVCLSSQAEAQGLTVGFYENSCPTVEAIIWESMRNSYNQDPTVAPGVLRLSFHDCFVRGCDASVLLDGEEAEKTAAINVNLHGFEAIDAAKAAVEAACPNTVSCADILQFAARDSVTLTGGEGWDVSGGRRDSLVSSYVDPPLGLPLQTDTVSELLANFAEKNLNAAHMVALSGGHSIGIAHCQYVTDRLYDYPSSDTGSDPTLPSDMQATLKTECPNAAATPELNVDEVTPDTFDSQYFNNIVKGRGLLASDQRLMDDKATSDAVLANNGPDFGGNFGRAMVVMARYNVLTGNAGQIRTNCRQVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1 and 2). No EST. Ecotype="Gransden 2004". Incorrect prediction from Phytozome (shorter PS).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGGAGGTAAATCCATCCAAGAGGATGCCGAATCATCGGCGGGGTTTGGCAACTGCATTGCTCACAATAGCCTTCGTATTTGTGTGCTTAAGCAGCCAAGCTGAGGCTCAAGGCCTT
ACAGTCGGGTTTTACGAGAACTCCTGCCCAACGGTTGAAGCAATAATCTGGGAATCAATGCGGAACTCGTACAATCAGGATCCAACAGTTGCGCCCGGCGTATTGCGTCTGTCATTCCAT
GATTGCTTCGTTCGT
GTGAGTTACAATGGAGCCATATAGTNNNNNNNNNNNNNNNNNNNNNNCAAATCCGTAATCTGTGTCCTTCTGTGAAATATAAGCTACTGTGAGCTTTGAATAGCT
GAACAGGTTGCAAAACTTCGGAATTAGACCTCGTGATTCTGTGCGGACAGCTGACAAATTCAATGAATTTTGTCGGAACAGGCAGAATGTGGGGTGCCTCTGTTCTTAACATTTGAGTTT
GGTTTCAGGGATGTGATGCTTCAGTGCTGTTGGACGGAGAAGAAGCGGAGAAGACGGCGGCAATCAACGTGAATCTACATGGGTTTGAAGCCATCGATGCGGCAAAAGCGGCAGTGGAAG
CGGCATGCCCGAACACTGTTTCATGCGCCGACATATTGCAGTTCGCAGCTCGTGACAGTGTGACGCTG
GTACGTTAGTGCTAGTCTCTCCACTTTGTGCGCTTGTCACGTTGACAAGCTT
GTTATTAAGCGTCTGAAGGGGGAGGAGTTAACGCAGGAGTCAGACTGTCTCTGTTGTGAAGACCGATTCCCACCTTCTAGTCACTCTGACAACAACTCATGGATCAGCAATTCGTGAAAA
TGGTGGCAAATTAGTTAATTCTTGCAAGTCGTCATACAGAGCTACTCAATCCTCAGCGGGAGAAGTTGCAATATAGTTAGAGAGGATTGCAAGGAACCGTGACTAGGAGCTTGCTATGTA
CACTTCATATTAGGTTCAGAAGCCCCATATTGTTGATATCGTCGCTGATGAAAGGCTTTCAAAATCTGTTGTTGCAATCGCAGACTGGAGGCGAAGGCTGGGATGTATCCGGTGGAAGGA
GAGACTCACTCGTATCAAGCTATGTAGATCCCCCTCTAGGGCTGCCTCTCCAAACCGACACCGTCTCGGAGCTTCTAGCTAATTTCGCGGAGAAGAATCTGAACGCCGCCCACATGGTCG
CGTTGTCAGGGGGTCACTCCATCGGTATAGCTCACTGCCAATACGTCACGGATCGTCTCTACGATTATCCCAGCAGCGATACAGGATCCGATCCTACCCTCCCATCCGACATGCAAGCAA
CGTTAAAGACGGAGTGTCCTAATGCAGCTGCCACCCCGGAACTCAATGTAGACGAGGTCACCCCAGACACCTTCGACTCCCAATACTTTAACAACATTGTCAAGGGCAGGGGGTTGCTTG
CTTCTGATCAACGTCTAATGGACGACAAAGCCACCAGTGACGCGGTTTTGGCCAATAACGGACCTGATTTCGGTGGCAATTTCGGAAGGGCTATGGTGGTGATGGCTCGGTACAATGTCC
TCACTGGCAACGCCGGTCAGATTCGCACTAATTGCCGACAGGTTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGGAGGTAAATCCATCCAAGAGGATGCCGAATCATCGGCGGGGTTTGGCAACTGCATTGCTCACAATAGCCTTCGTATTTGTGTGCTTAAGCAGCCAAGCTGAGGCTCAAGGCCTT
ACAGTCGGGTTTTACGAGAACTCCTGCCCAACGGTTGAAGCAATAATCTGGGAATCAATGCGGAACTCGTACAATCAGGATCCAACAGTTGCGCCCGGCGTATTGCGTCTGTCATTCCAT
GATTGCTTCGTTCGT
GGATGTGATGCTTCAGTGCTGTTGGACGGAGAAGAAGCGGAGAAGACGGCGGCAATCAACGTGAATCTACATGGGTTTGAAGCCATCGATGCGGCAAAAGCGGCA
GTGGAAGCGGCATGCCCGAACACTGTTTCATGCGCCGACATATTGCAGTTCGCAGCTCGTGACAGTGTGACGCTG
ACTGGAGGCGAAGGCTGGGATGTATCCGGTGGAAGGAGAGACTCA
CTCGTATCAAGCTATGTAGATCCCCCTCTAGGGCTGCCTCTCCAAACCGACACCGTCTCGGAGCTTCTAGCTAATTTCGCGGAGAAGAATCTGAACGCCGCCCACATGGTCGCGTTGTCA
GGGGGTCACTCCATCGGTATAGCTCACTGCCAATACGTCACGGATCGTCTCTACGATTATCCCAGCAGCGATACAGGATCCGATCCTACCCTCCCATCCGACATGCAAGCAACGTTAAAG
ACGGAGTGTCCTAATGCAGCTGCCACCCCGGAACTCAATGTAGACGAGGTCACCCCAGACACCTTCGACTCCCAATACTTTAACAACATTGTCAAGGGCAGGGGGTTGCTTGCTTCTGAT
CAACGTCTAATGGACGACAAAGCCACCAGTGACGCGGTTTTGGCCAATAACGGACCTGATTTCGGTGGCAATTTCGGAAGGGCTATGGTGGTGATGGCTCGGTACAATGTCCTCACTGGC
AACGCCGGTCAGATTCGCACTAATTGCCGACAGGTTAACTAA

Retrieve as FASTA