Entry information : ZmPrx08
Entry ID 171
Creation 2007-11-19 (Christophe Dunand)
Last sequence changes 2010-12-23 (Marie Brette (Scipio))
Sequence status complete
Reviewer Filippo Passardi
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx08
Name ZmPrx08
Class Class III peroxidase    [Orthogroup: Prx095]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx08
start..stop
S start..stop
ZmPrx09 612 0 1..352 1..350
ZmPrx97 610 0 1..352 1..350
ZmPrx30 597 0 1..351 2..390
SbPrx37 589 0 1..352 2..365
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 168905122..168905397 276 N° 2 168904258..168905040 783  
complement(join(168904258..168905040,168905122..168905397))


exon

Literature and cross-references ZmPrx08
Literature Duvick,J.P., Maddox,J.R., Navarro Acevedo,P.A. and Simmons,C.R.
Maize peroxidase genes and their use for improving plant disease resistance and stalk strength
DNA ref. GenBank:   AC195916.2 (103915..105054)   AC206295.1 (68134..69270)
Protein sequence: ZmPrx08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   352 (332)
PWM (Da):   %s   37917.81 (35941.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.93 (7.72) Peptide Signal:   %s   cut: 21 range:21-352
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSKLAVLALFALLGSVSCQAGGYYDYYYPTPQRPPTPSPAGTHLKVGYYRNKCAAAYVDVEAIVKKHVKATDAGMQAGLVRLFFHDCFVRGCDGSILLDTFSNDTSLTPEKFGVPNFPSLRGFEVIDAAKAEIEAACPGKVSCADIVAFAARDASYFLSAGGISFAMPAGRYDGTVSLASETLPNLPPPFAGFDQLVKMFGDKGLDASDMITLSGAHSIGRSHCSSFTRDRLPPSNTSDMDPAFAATLQAKCRSANAGTDNTVMQDFKSPDVLDNQYYKNVLAHKVLFTSDAALTTNFTSNNLVRAYADFVPYLWQQKFEKAMVKMGGIQLKTADNGEIRKTCRKVNNRT*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, intron 1). No EST. AC206295.1 contains 6 peroxidases.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACCTCTAAGCTCGCTGTCCTCGCTCTGTTTGCCCTGCTCGGCTCCGTGTCATGCCAGGCCGGAGGCTACTACGACTACTACTACCCTACCCCGCAGCGACCTCCAACACCAAGC
CCTGCAGGGACGCACCTCAAGGTCGGATACTACAGGAACAAGTGTGCCGCCGCTTACGTGGATGTGGAGGCCATTGTCAAGAAGCACGTCAAGGCCACTGATGCTGGCATGCAAGCTGGC
CTTGTCCGTCTCTTCTTCCACGATTGCTTCGTCCGT
GTAAGACACTAGCTAGCACAACTTCCTCCATTCATGCGATCTGACAAACAATTACTTAATAACATGGTTTCGTCTCGTCAGGGA
TGCGACGGCTCCATCCTCCTCGACACGTTCAGCAACGACACAAGCCTGACCCCGGAGAAGTTCGGCGTGCCCAACTTCCCCAGCCTGCGGGGCTTCGAGGTGATCGACGCGGCCAAAGCC
GAGATCGAGGCGGCGTGCCCGGGCAAGGTCTCGTGCGCGGACATCGTCGCCTTCGCCGCCCGCGACGCGTCCTACTTCCTCAGCGCCGGCGGCATCAGCTTCGCCATGCCAGCGGGCCGC
TACGACGGGACCGTCTCCCTCGCCAGCGAGACCCTCCCCAACCTGCCCCCGCCGTTCGCCGGCTTCGACCAGCTCGTCAAGATGTTCGGCGACAAGGGCCTCGACGCCTCCGACATGATC
ACGCTCTCCGGCGCGCACAGCATCGGCCGCTCACACTGCTCCTCCTTCACCAGGGACCGCCTGCCGCCCAGCAACACCTCCGACATGGACCCGGCGTTCGCCGCCACGCTGCAGGCCAAA
TGCAGGTCGGCGAATGCTGGCACCGACAACACGGTGATGCAGGACTTCAAGTCCCCCGACGTCCTGGATAACCAGTACTACAAGAACGTGCTGGCCCACAAGGTTCTCTTCACGTCCGAC
GCCGCGCTCACCACCAACTTCACGTCCAACAACCTGGTGCGTGCCTACGCCGACTTCGTGCCCTATCTGTGGCAGCAGAAGTTCGAAAAAGCTATGGTGAAGATGGGTGGCATCCAGCTC
AAGACCGCAGACAATGGGGAGATCAGGAAGACGTGCCGCAAAGTCAACAACAGGACGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACCTCTAAGCTCGCTGTCCTCGCTCTGTTTGCCCTGCTCGGCTCCGTGTCATGCCAGGCCGGAGGCTACTACGACTACTACTACCCTACCCCGCAGCGACCTCCAACACCAAGC
CCTGCAGGGACGCACCTCAAGGTCGGATACTACAGGAACAAGTGTGCCGCCGCTTACGTGGATGTGGAGGCCATTGTCAAGAAGCACGTCAAGGCCACTGATGCTGGCATGCAAGCTGGC
CTTGTCCGTCTCTTCTTCCACGATTGCTTCGTCCGT
GGATGCGACGGCTCCATCCTCCTCGACACGTTCAGCAACGACACAAGCCTGACCCCGGAGAAGTTCGGCGTGCCCAACTTCCCC
AGCCTGCGGGGCTTCGAGGTGATCGACGCGGCCAAAGCCGAGATCGAGGCGGCGTGCCCGGGCAAGGTCTCGTGCGCGGACATCGTCGCCTTCGCCGCCCGCGACGCGTCCTACTTCCTC
AGCGCCGGCGGCATCAGCTTCGCCATGCCAGCGGGCCGCTACGACGGGACCGTCTCCCTCGCCAGCGAGACCCTCCCCAACCTGCCCCCGCCGTTCGCCGGCTTCGACCAGCTCGTCAAG
ATGTTCGGCGACAAGGGCCTCGACGCCTCCGACATGATCACGCTCTCCGGCGCGCACAGCATCGGCCGCTCACACTGCTCCTCCTTCACCAGGGACCGCCTGCCGCCCAGCAACACCTCC
GACATGGACCCGGCGTTCGCCGCCACGCTGCAGGCCAAATGCAGGTCGGCGAATGCTGGCACCGACAACACGGTGATGCAGGACTTCAAGTCCCCCGACGTCCTGGATAACCAGTACTAC
AAGAACGTGCTGGCCCACAAGGTTCTCTTCACGTCCGACGCCGCGCTCACCACCAACTTCACGTCCAACAACCTGGTGCGTGCCTACGCCGACTTCGTGCCCTATCTGTGGCAGCAGAAG
TTCGAAAAAGCTATGGTGAAGATGGGTGGCATCCAGCTCAAGACCGCAGACAATGGGGAGATCAGGAAGACGTGCCGCAAAGTCAACAACAGGACGTGA

Retrieve as FASTA