Entry information : ZmPrx09
Entry ID 172
Creation 2007-11-19 (Christophe Dunand)
Last sequence changes 2007-11-19 (Christophe Dunand)
Sequence status complete
Reviewer Filippo Passardi
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx09
Name ZmPrx09
Class Class III peroxidase    [Orthogroup: Prx095]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx09
start..stop
S start..stop
ZmPrx97 710 0 1..350 1..350
ZmPrx08 610 0 1..350 1..352
SbPrx37 595 0 1..350 2..365
SbPrx36 584 0 1..349 2..368
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 168866228..168866500 273 N° 2 168865319..168866098 780  
complement(join(168865319..168866098,168866228..168866500))


exon

Literature and cross-references ZmPrx09
Literature Duvick,J.P., Maddox,J.R., Navarro Acevedo,P.A. and Simmons,C.R.
Maize peroxidase genes and their use for improving plant disease resistance and stalk strength
DNA ref. GenBank:   AC206295.2 (191206..192240)
Protein sequence: ZmPrx09
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (330)
PWM (Da):   %s   37437.57 (35401.5)  
PI (pH):   %s   6.65 (6.35) Peptide Signal:   %s   cut: 21 range:21-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTSKLAVLTLFALLGSVSCQSGGYYFYPTPQQPSPTPSPPPSPQLMVGYYKDKCAAYVDVEAIVKKHVKATDAGMQAGLVRLLFHDCFVRGCDGSVLLDTFSNDTSLTPEKFGVPNFPSLRGFEVIDAAKAEIEAACPGTVSCADIVAFAARDASNFLSGGGISFAMPAGRYDGNVSLASETLPNLPSPFTGFDQLVKVFADKGLDAFDMITLSGAHSIGRSHCSSFTRDRLPPSNTSDIDPAFAATLQASCASPNGTDNTVMQDFKTPDVLDNQYYKNVLAHKVLFTSDAALTTNFTSNNLVRAYADFVPYLWQQKFAKAMVKMAGVEIKTAANGEIRKTCRKVNSRS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, intron 1). No EST. Contig contains 6 other peroxidases.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAACCTCTAAGCTTGCTGTCCTCACTCTGTTTGCCCTGCTCGGCTCCGTGTCATGCCAGTCCGGAGGCTACTACTTCTACCCAACCCCGCAGCAACCATCTCCAACACCCAGCCCT
CCTCCTAGTCCGCAACTCATGGTCGGATACTACAAGGACAAGTGTGCCGCTTACGTGGATGTTGAAGCCATTGTCAAGAAGCACGTCAAGGCCACCGATGCTGGCATGCAGGCCGGGCTT
GTCCGTCTCTTATTCCACGACTGCTTCGTCCGT
GTAAGAGCAGCTCCATCATTCACCAATGCAAGCTAGCCATGCAGGCCGTACATTCCATTCAATTCATGCATGCAGTCAGACATAATG
ACGTTGCCATCGCCATGTGTGTGTACGTGGTGGTTTCTGCAGGGATGCGACGGCTCCGTCCTCCTCGACACGTTCAGCAACGACACCAGCCTGACCCCGGAGAAGTTCGGCGTGCCCAAC
TTCCCCAGCCTGCGGGGCTTCGAGGTGATCGACGCGGCCAAAGCCGAGATCGAGGCGGCGTGCCCCGGCACGGTCTCGTGCGCGGACATCGTCGCGTTCGCCGCCCGCGACGCGTCCAAC
TTCCTCAGCGGCGGCGGCATCAGCTTCGCCATGCCCGCGGGGCGCTACGACGGGAACGTCTCCCTCGCCAGCGAGACCCTCCCCAACCTGCCCTCCCCGTTCACCGGCTTCGACCAGCTC
GTCAAGGTGTTCGCCGACAAAGGGCTCGACGCCTTCGACATGATCACGCTCTCCGGCGCGCACAGCATCGGCCGCTCCCACTGCTCCTCCTTCACCAGGGACCGCCTGCCGCCCAGCAAC
ACCTCCGACATAGACCCAGCGTTCGCCGCCACGCTGCAGGCTAGCTGCGCGTCGCCCAACGGCACCGACAACACGGTCATGCAGGACTTCAAGACCCCCGACGTCCTGGACAACCAGTAC
TACAAGAACGTGCTGGCCCACAAGGTTCTCTTCACGTCGGACGCCGCGCTCACCACCAACTTCACGTCCAACAACCTGGTGCGCGCCTACGCGGACTTCGTGCCCTATCTGTGGCAGCAG
AAGTTCGCCAAAGCCATGGTGAAGATGGCCGGCGTCGAGATCAAAACCGCCGCCAACGGAGAGATCAGGAAGACATGCCGCAAGGTCAACAGCAGGTCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAACCTCTAAGCTTGCTGTCCTCACTCTGTTTGCCCTGCTCGGCTCCGTGTCATGCCAGTCCGGAGGCTACTACTTCTACCCAACCCCGCAGCAACCATCTCCAACACCCAGCCCT
CCTCCTAGTCCGCAACTCATGGTCGGATACTACAAGGACAAGTGTGCCGCTTACGTGGATGTTGAAGCCATTGTCAAGAAGCACGTCAAGGCCACCGATGCTGGCATGCAGGCCGGGCTT
GTCCGTCTCTTATTCCACGACTGCTTCGTCCGT
GGATGCGACGGCTCCGTCCTCCTCGACACGTTCAGCAACGACACCAGCCTGACCCCGGAGAAGTTCGGCGTGCCCAACTTCCCCAGC
CTGCGGGGCTTCGAGGTGATCGACGCGGCCAAAGCCGAGATCGAGGCGGCGTGCCCCGGCACGGTCTCGTGCGCGGACATCGTCGCGTTCGCCGCCCGCGACGCGTCCAACTTCCTCAGC
GGCGGCGGCATCAGCTTCGCCATGCCCGCGGGGCGCTACGACGGGAACGTCTCCCTCGCCAGCGAGACCCTCCCCAACCTGCCCTCCCCGTTCACCGGCTTCGACCAGCTCGTCAAGGTG
TTCGCCGACAAAGGGCTCGACGCCTTCGACATGATCACGCTCTCCGGCGCGCACAGCATCGGCCGCTCCCACTGCTCCTCCTTCACCAGGGACCGCCTGCCGCCCAGCAACACCTCCGAC
ATAGACCCAGCGTTCGCCGCCACGCTGCAGGCTAGCTGCGCGTCGCCCAACGGCACCGACAACACGGTCATGCAGGACTTCAAGACCCCCGACGTCCTGGACAACCAGTACTACAAGAAC
GTGCTGGCCCACAAGGTTCTCTTCACGTCGGACGCCGCGCTCACCACCAACTTCACGTCCAACAACCTGGTGCGCGCCTACGCGGACTTCGTGCCCTATCTGTGGCAGCAGAAGTTCGCC
AAAGCCATGGTGAAGATGGCCGGCGTCGAGATCAAAACCGCCGCCAACGGAGAGATCAGGAAGACATGCCGCAAGGTCAACAGCAGGTCCTGA

Retrieve as FASTA