Entry information : ZmPrx78 (GRMZM2G504757)
Entry ID 178
Creation 2009-01-12 (Christophe Dunand)
Last sequence changes 2011-01-20 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-09 (Qiang Li)
Peroxidase information: ZmPrx78 (GRMZM2G504757)
Name (synonym) ZmPrx78 (GRMZM2G504757)
Class Class III peroxidase    [Orthogroup: Prx095]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx78
start..stop
S start..stop
ZmPrx30 658 0 1..391 1..391
ZmPrx09 612 0 2..390 1..349
ZmPrx97 610 0 2..390 1..349
SbPrx37 608 0 1..390 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..396 396 N° 2 522..1301 780  
join(1..396,522..1301)


exon

Literature and cross-references ZmPrx78 (GRMZM2G504757)
Literature Wilson,R.K., Ko,A., Levy,A. and Ochoa,K. he sequence of Zea mays bac clone CH201-476N23
DNA ref. GenBank:   AC195916.2 (115444..116744)   AC206295 (156335..157066) [Fragment]
Protein sequence: ZmPrx78 (GRMZM2G504757)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   391 (370)
PWM (Da):   %s   41294.35 (39175.2)  
PI (pH):   %s   5.95 (5.62) Peptide Signal:   %s   cut: 22 range:22-391
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMSPSKLAVLTVFALLGSVSSQGGSYYYTPPAPATPQPPPCPPPVTPVPPPTSPPTYPPPTPTSPPAPTPTPPPPPPPPPSSPGTQLTVGHYKNKCGAYVDVEAIVKKHVSATDAGMQAGLVRLFFHDCFVRGCDGSVLLDTFSNDTSLTPEKFGVPNFPSLRGFEVIDAAKDEIEAACPGTVSCADIVAFAARDASYFLSGGGISFAMPAGRYDGTVSLASETLPNLPPPFAGFDQLVKMFDDKGLDAFDMITLSGAHSIGRSHCSSFTRDRLPPSNTSDMDPAFAATLQASCASANGTDNTVMQDFATPDVLDNQYYKNVLAHKVLFTSDAALTTNFTSNNLVRAYADFVPYLWQQKFAKAMVKMGGVEIKTAANGEIRKTCRKINSRP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, intron 1). No EST. Not predicted from Phytozome (undetermined residus in 5'=> exon 1 is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGCCCTAGTAAGCTCGCCGTCCTCACTGTGTTCGCCCTGCTCGGCTCCGTGTCAAGCCAGGGCGGAAGCTACTACTACACTCCTCCGGCTCCGGCCACCCCGCAACCACCGCCA
TGTCCTCCTCCTGTCACTCCGGTGCCCCCGCCAACGTCACCACCCACTTATCCTCCACCGACCCCGACGAGCCCACCCGCGCCTACGCCCACACCCCCACCCCCACCCCCACCCCCACCC
AGCAGCCCTGGGACGCAACTCACGGTCGGACACTACAAGAACAAGTGTGGCGCTTACGTGGATGTCGAAGCTATTGTCAAGAAGCACGTCAGTGCCACTGATGCTGGTATGCAGGCCGGG
CTTGTCCGTCTCTTCTTCCACGACTGCTTCGTCCGT
GTAAGAGCTCCATTACCGACCAAGCAAGCCATGCCGTACATAGTGCATACCATTCATGCATGCAGTCAGACAGTTAATTAATGA
CGTTGCCATCGCCATGTGTGTGTACGTGGTGGTTTCTGCAGGGATGCGACGGCTCCGTCCTCCTCGACACGTTCAGCAACGACACCAGCCTGACCCCGGAGAAGTTCGGCGTGCCCAACT
TCCCCAGCCTGCGGGGCTTCGAGGTGATCGACGCGGCGAAAGACGAGATCGAGGCGGCGTGCCCCGGCACGGTCTCGTGCGCGGACATCGTCGCCTTCGCCGCCCGCGACGCGTCCTACT
TCCTCAGCGGCGGCGGCATCAGCTTCGCCATGCCCGCGGGCCGCTACGACGGGACCGTCTCCCTCGCCAGCGAGACCCTCCCCAACCTGCCCCCGCCGTTCGCCGGCTTCGACCAGCTCG
TCAAGATGTTCGACGACAAGGGGCTCGACGCCTTCGACATGATCACGCTCTCCGGCGCGCACAGCATCGGCCGCTCCCACTGCTCCTCCTTCACCAGGGACCGCCTGCCGCCCAGCAACA
CCTCCGACATGGACCCGGCGTTCGCCGCCACGCTGCAGGCTAGCTGCGCGTCGGCCAACGGCACCGACAACACGGTGATGCAGGACTTCGCCACCCCTGACGTCCTGGACAACCAGTACT
ACAAGAATGTGCTGGCCCACAAGGTTCTCTTCACGTCGGACGCCGCGCTCACCACCAACTTCACGTCCAACAACCTGGTGCGCGCCTACGCGGACTTCGTGCCCTATCTGTGGCAGCAGA
AGTTCGCGAAAGCCATGGTGAAGATGGGCGGCGTCGAGATCAAAACCGCCGCCAATGGAGAGATCAGGAAGACATGCCGCAAGATCAACAGCAGGCCGTGA

Retrieve as FASTA