Entry information : SbPrxII03 (Sobic.003G254300.1 [2.1] / Sb03g030950 [1.4] / SbPrxIIC)
Entry ID 1783
Creation 2007-10-01 (Christophe Dunand)
Last sequence changes 2007-10-01 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrxII03 (Sobic.003G254300.1 [2.1] / Sb03g030950 [1.4] / SbPrxIIC)
Name (synonym) SbPrxII03 (Sobic.003G254300.1 [2.1] / Sb03g030950 [1.4] / SbPrxIIC)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Rhizomes
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrxII03
start..stop
S start..stop
SpPrxII03 327 1e-117 1..162 1..162
ZmPrxII03 324 3e-116 1..162 1..162
HvPrxII03 310 9e-111 1..162 1..162
ScPrxII03 303 5e-108 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 59281989..59282143 155 N° 2 59280753..59280832 80 N° 3 59279934..59280187 254  
complement(join(59279934..59280187,59280753..59280832,59281989..59282143))


exon

Literature and cross-references SbPrxII03 (Sobic.003G254300.1 [2.1] / Sb03g030950 [1.4] / SbPrxIIC)
Literature Cordonnier-Pratt,M.-M., Suzuki,Y., Sugano,S., Klein,R., Lim,S., Liang,C., Sun,F. and Pratt,L.H. A Sorghum EST database: anaerobic roots.
DNA ref. Phytozome 11:   chromosome_3 (59282143..59279934)
EST ref. GenBank:   CX610141
Cluster/Prediction ref. UniGene:   Sbi.6951
Protein sequence: SbPrxII03 (Sobic.003G254300.1 [2.1] / Sb03g030950 [1.4] / SbPrxIIC)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17256  
PI (pH):   %s   4.78
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIAVGDSLPDGQLGWFDENDQLQQVSVHALAAGKKVILFGVPGAFTPTCSNQHVPGFITQAEQLKAKGVDEILLIVNDPFVMKAWAKTYPENKHVKFLADGSGAYTKALDLELDLTEKGLGVRSKRFALLADDLKVTVANIEEGGQFTISGAEEILKAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 2 introns) and 14 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCGATCGCTGTCGGCGACTCCCTCCCCGACGGCCAGCTCGGGTGGTTCGACGAGAACGACCAGCTGCAGCAGGTCTCCGTCCACGCGCTCGCCGCCGGCAAGAAGGTCATCCTC
TTCGGCGTCCCCGGCGCCTTCACCCCGACCTGCAG
GTCCCTATACCCACCCCCCCCCCCCCCCCCCCTTTTCCCGTGCCCGTCTCTTCTCCTCCCGCTTTCTCGGAGATCTCCGAGCTTT
TTGGACCTGTGTTTGTGTTTCTGGGGGAGAGAGATGTCTTTCTAGGTCTCGTCGGGGCGGAGGGGGATTATCTGGGATCTTTTGGAACTAGTTCTATTTCGTATTCGGAATGAAATACTA
GTTAGTTTTGAGCAATAGATCGACAGTAGACTATTTTTTTAGAGTTTTATTAGGGATATATATACCCCCGATCTTAGCCATGCCAGATCGACAGCACATCTGCTGCACGCGGTATCCGGC
AGAGGAGAGCAACCAACCATGCTTGCGCGCTGAGAGGATCGTGAAATAACCAGGCCTTGAAGTGTAGCACAACCGGTTCCACCTCCTAGTTAGCGTCAGGTGCATTGCTGGCAGTAAGGA
GTAGGGTCTGAACCTGTCAATGTTGGGTCAGCAAGAAAACCACGGTCTTCAAGGGGAAGGAGGGGCCTATTGAGTTCACCCCAACGGTGCATGCCGCTTGATAAGGACTATGTTGTTGAG
ATTTGGGCCTTCAAGCAGCACCCATCCCACAACTTTGGGAAGATAATGAATGTGTCGTGTAGGTACGGGTTGTTAAGAAAGATAAGCAACTGCAGTTCAACTATGGCCCCCTGCTCCCTT
CCCAGTGAATGGATTGTGATAGTGTAACTACACGCCAGTGTATTTTTCATGAATCGTAGCTTCCCTCTTTAACTACTGGATTTTATCTAGTCTACCTACAACCCATGATTTTCAGTTTAG
TGTGAACAAAGGTATTATCTAGTGCTTATTGCTCCTTTCATTCCAAATTGTAAGCGGTTCGGGCCTTTTCTGTCTATACATAGTAAAATCTATGTATCTAAAATAGTAAGAACTAAGAAC
TACTTACAATTTGGAATCGAGGGAATACTGACATAAAGTTGATTAGCTGCTTTAGTCTATAAGTTCAATGGAAAATTCCAAATTACTTAAAATTTTAAAAATTTGAAGGTAATTCCACTA
ACTGAAGCCAAGAGTTTTCTTGCTCTTGTATCTCTGAAATCCTTCAATTGTTTCGTGAAATGCTGAAGTACTCAGGCTGTCTCTTTCTGTGCATTTCTTCTATGTTCACAGCAACCAGCA
TGTGCCAGGCTTCATTACACAGGCTGAGCAGCTCAAAGCCAAGGGTGTAGACGAGATCCTGCTTATCAGCG
GTATGCTTGCCTATCTATCTGTATTTGTGAAGACAGTTGTTTTGATAAT
TTTTTCATTGCAAATACCAGAGTTGAATAAGAAGCAGTGTGGTCAAACTTATATTGTTCATTCAGATACTGTGATTTTCTTAATGTTCTTTGCATAGCTGTATGGTAGCTCTGCAAAATG
TTTTGATACACAATGTTATGTTTTTGCATAGTTGTTTTGATACACAATGTTAATGTTTCTTATCGTACTTCATCGTTGAACATTGATGGTATGCTATGTTCCATAAGCATTCGATGTTAT
ATTTTTTATCGTACTTCATCATTGAACATTGATTTTTTATCGTAAAACAGCAAAATGCTAAGTGATAGTATGCTATGTTCCATAAGCATTATGGTGCATCTGTAAATAATTGCTGTCAGG
AAGCTAGAGCATTGGTCATATTTATTAGTAACTGTAAATCTGTTCTACCCCTTGGCTACCTGCTGAATGTCATCAGTTTGCCATGTTGTGATTATGACTTTGATCAAAAGTAGCTTGGCC
AGACTATGACATAATTTGCTGCATTGTGATACGCAGTAAACGACCCATTTGTCATGAAGGCATGGGCAAAGACTTACCCTGAGAACAAACATGTGAAGTTCCTTGCTGACGGGTCTGGAG
CATACACCAAGGCACTCGATCTTGAGCTTGATCTTACAGAGAAAGGACTGGGTGTCCGCTCCAAAAGGTTTGCTCTTCTGGCAGACGACCTCAAGGTCACTGTCGCAAACATCGAGGAAG
GTGGACAGTTCACAATCTCTGGTGCTGAGGAGATCCTGAAAGCGCTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCGATCGCTGTCGGCGACTCCCTCCCCGACGGCCAGCTCGGGTGGTTCGACGAGAACGACCAGCTGCAGCAGGTCTCCGTCCACGCGCTCGCCGCCGGCAAGAAGGTCATCCTC
TTCGGCGTCCCCGGCGCCTTCACCCCGACCTGCAG
CAACCAGCATGTGCCAGGCTTCATTACACAGGCTGAGCAGCTCAAAGCCAAGGGTGTAGACGAGATCCTGCTTATCAGCGTAAAC
GACCCATTTGTCATGAAGGCATGGGCAAAGACTTACCCTGAGAACAAACATGTGAAGTTCCTTGCTGACGGGTCTGGAGCATACACCAAGGCACTCGATCTTGAGCTTGATCTTACAGAG
AAAGGACTGGGTGTCCGCTCCAAAAGGTTTGCTCTTCTGGCAGACGACCTCAAGGTCACTGTCGCAAACATCGAGGAAGGTGGACAGTTCACAATCTCTGGTGCTGAGGAGATCCTGAAA
GCGCTTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACCCGCAAT CAAGTCCCCA TTCACTCGCC TGCGCTTCCT CTCCTCGCCG CGCCGCCCGG CTGCCCCCCA CCCCACCCCT CCTGCACGCA AGGCCATGGC TCCGATCGCT GTCGGCGACT  CCCTCCCCGA CGGCCAGCTC GGGTGGTTCG ACGAGAACGA CCAGCTGCAG CAGGTCTCCG TCCACGCGCT CGCCGCCGGC AAGAAGGTCA TCCTCTTCGG CGTCCCCGGC GCCTTCACCC  CGACCTGCAG CAACCAGCAT GTGCCAGGCT TCATTACACA GGCTGAGCAG CTCAAAGCCA AGGGTGTAGA CGAGATCCTG CTTATCAGCG TAAACGACCC ATTTGTCATG AAGGCATGGG  CAAAGACTTA CCCTGAGAAC AAACATGTGA AGTTCCTTGC TGACGGGTCT GGAGCATACA CCAAGGCACT CGATCTTGAG CTTGATCTTA CAGAGAAAGG ACTGGGTGTC CGCTCCAAAA  GGTTTGCTCT TCTGGCAGAC GACCTCAAGG TCACTGTCGC AAACATCGAG GAAGGTGGAC AGTTCACAAT CTCTGGTGCT GAGGAGATCC TGAAAGCGCT TTAGGAGTTT GATCTCTTCT  ATCAAAAAGC TCGGCAATGT TGTGGACACC AGTCTAATTT GAACTTTGAA CTCATCTTTG AATAACTTGC CGTCGGACAA GATCAGTTCC ATGATGTATA TGAAACGGTC GTCGTTGAGT 
CATGCACAAT TTGGTATTTT CATATGTTAT ATTCGCCGGT TCGAGTAACT TTCGATTCGT CGTTACACAA AGTTGATGCT GAGAAATCGA CAAGTATTTT ACTGCC 

Retrieve as FASTA