Entry information : ZmPrx07 (P7X / GRMZM2G133475)
Entry ID 180
Creation 2006-09-04 (Christophe Dunand)
Last sequence changes 2011-01-21 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-21 (Christophe Dunand)
Peroxidase information: ZmPrx07 (P7X / GRMZM2G133475)
Name (synonym) ZmPrx07 (P7X / GRMZM2G133475)
Class Class III peroxidase    [Orthogroup: Prx111]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx07
start..stop
S start..stop
ZmPrx66 635 0 1..320 1..320
ZmPrx42 478 7e-172 3..320 2..320
ZmPrx114 477 2e-171 30..319 24..313
SbPrx47 445 4e-159 1..320 1..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 216785798..216786025 228 N° 2 216786124..216786309 186 N° 3 216786416..216786578 163 N° 4 216786673..216787058 386
join(216785798..216786025,216786124..216786309,216786416..216786578,216786673..2 16787058)


exon

Literature and cross-references ZmPrx07 (P7X / GRMZM2G133475)
Literature Padegimas L.S., Reichert N.A. Isolation and characterization of peroxidase genes and regulatory sequences. Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
Protein ref. UniProtKB:   Q9ZTS7 [Fragment]
mRNA ref. GenBank:   AF037034
Cluster/Prediction ref. UniGene:   Zm.405
Protein sequence: ZmPrx07 (P7X / GRMZM2G133475)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (291)
PWM (Da):   %s   33366.61 (30722.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.15 (8.21) Peptide Signal:   %s   cut: 30 range:30-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASVSASCLISLSSLAVVLVALASAASAQLSSTFYDRSCPNALSTIRSGVNSAVRQEPRVGASLLRLHFHDCFVRGCDASLLLNDTSGEQSQGPNLTLNPRGFVVVNSIKAQVESVCPGIVSCADILAVAARDGVVALGGPSWTVLLGRRDSTASFPGQTSDLPPPTSSLRQLLSAYNKKNLNPTDMVALSGAHTIGQAQCSSFNDHIYNDTNINSAFAASLRANCPRAGSTALAPLDTTTPNAFDNAYYTNLLSQKGLLHSDQELFNSGSTDSTVRSFASSTSAFNSAFATAMVKMGNLSPQTGTQGQIRRSCWKVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 2, 3 introns) and 2 mRNA. Contig also contains a second sequence. Cultivar="MP307".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCCTCTGTTTCTGCCTCTTGCCTTATTAGCCTGTCGTCGTTGGCGGTGGTGCTGGTGGCGCTGGCGTCGGCGGCGTCGGCGCAGCTGTCGTCGACGTTCTACGACAGGTCATGC
CCCAACGCGCTGTCCACCATCAGGAGCGGCGTGAACTCCGCGGTGAGGCAGGAGCCTCGCGTGGGGGCGTCGCTGCTCAGGCTCCATTTCCACGACTGCTTTGTCCGG
GCAAGTGAAGTC
TCCGTCATCTTTTCTGCTTTCTTTCTAGAAAACACATCCATGACCCCAGCAAAACTGAGCTTAAAAAACCCTAAATATTTCTGCAGGGCTGCGACGCGTCCCTTCTGCTGAACGACACGT
CAGGGGAGCAGAGCCAGGGCCCGAATCTAACTCTGAACCCGAGGGGCTTCGTTGTCGTGAACAGCATCAAGGCGCAGGTGGAGTCCGTGTGCCCGGGGATCGTCTCCTGCGCCGACATAC
TCGCCGTGGCCGCCCGCGACGGAGTCGTAGCG
GTGAGAGATGAAGACTAGATAGATCATAGATATATCCCTGCTAGCTAGCTAGCTAGGTTATGACCTGATGATGATGATGTACGCATGC
ATATCATATCCTATCCAGCTCGGCGGGCCTTCGTGGACAGTTCTACTAGGGCGAAGGGACTCTACCGCTTCATTCCCAGGCCAGACAAGCGACCTCCCACCTCCGACGTCTAGCCTCCGA
CAGCTTTTGTCTGCGTATAACAAGAAGAACCTCAACCCAACCGACATGGTTGCACTCTCAG
GTGCCCTCCTATCCTAGCTAGCAGTAGCAGCTAGCTTAGCTACTGATCGACGATGACGA
TGATATATATAATACCTTTCCATATATACATGCAGGAGCTCACACGATCGGACAGGCGCAGTGCTCGAGCTTCAACGACCACATCTACAACGACACCAACATCAACTCCGCCTTCGCGGC
GTCGCTCAGGGCCAACTGCCCCAGGGCAGGCAGCACCGCCCTTGCGCCGCTGGACACCACGACGCCCAACGCGTTCGACAACGCCTACTACACCAACCTGCTGTCCCAGAAGGGGCTCCT
GCACTCGGACCAGGAGCTCTTCAACAGCGGCAGCACCGACAGCACGGTCAGGAGCTTCGCGTCCAGCACGTCGGCCTTCAACAGCGCCTTCGCCACGGCCATGGTCAAGATGGGCAACCT
CAGCCCCCAGACCGGAACCCAGGGGCAGATCAGGCGCAGCTGCTGGAAGGTCAACTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCCTCTGTTTCTGCCTCTTGCCTTATTAGCCTGTCGTCGTTGGCGGTGGTGCTGGTGGCGCTGGCGTCGGCGGCGTCGGCGCAGCTGTCGTCGACGTTCTACGACAGGTCATGC
CCCAACGCGCTGTCCACCATCAGGAGCGGCGTGAACTCCGCGGTGAGGCAGGAGCCTCGCGTGGGGGCGTCGCTGCTCAGGCTCCATTTCCACGACTGCTTTGTCCGG
GGCTGCGACGCG
TCCCTTCTGCTGAACGACACGTCAGGGGAGCAGAGCCAGGGCCCGAATCTAACTCTGAACCCGAGGGGCTTCGTTGTCGTGAACAGCATCAAGGCGCAGGTGGAGTCCGTGTGCCCGGGG
ATCGTCTCCTGCGCCGACATACTCGCCGTGGCCGCCCGCGACGGAGTCGTAGCG
CTCGGCGGGCCTTCGTGGACAGTTCTACTAGGGCGAAGGGACTCTACCGCTTCATTCCCAGGCCAG
ACAAGCGACCTCCCACCTCCGACGTCTAGCCTCCGACAGCTTTTGTCTGCGTATAACAAGAAGAACCTCAACCCAACCGACATGGTTGCACTCTCAG
GAGCTCACACGATCGGACAGGCG
CAGTGCTCGAGCTTCAACGACCACATCTACAACGACACCAACATCAACTCCGCCTTCGCGGCGTCGCTCAGGGCCAACTGCCCCAGGGCAGGCAGCACCGCCCTTGCGCCGCTGGACACC
ACGACGCCCAACGCGTTCGACAACGCCTACTACACCAACCTGCTGTCCCAGAAGGGGCTCCTGCACTCGGACCAGGAGCTCTTCAACAGCGGCAGCACCGACAGCACGGTCAGGAGCTTC
GCGTCCAGCACGTCGGCCTTCAACAGCGCCTTCGCCACGGCCATGGTCAAGATGGGCAACCTCAGCCCCCAGACCGGAACCCAGGGGCAGATCAGGCGCAGCTGCTGGAAGGTCAACTCG
TAA

Retrieve as FASTA