Entry information : OsAPx02 (APX2 / APXb)
Entry ID 1866
Creation 2006-09-05 (Christophe Dunand)
Last sequence changes 2006-09-05
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsAPx02 (APX2 / APXb)
Name (synonym) OsAPx02 (APX2 / APXb)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation Cytosolic
Tissue types Callus
Flowers
Leaves
Pannicles
Radicles
Roots
Seedlings
Spikes
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsAPx02
start..stop
S start..stop
OmAPx02 503 0 4..251 4..251
HvAPx03 472 7e-172 1..250 1..250
SbAPx02 472 7e-172 4..250 3..249
TaAPx04 472 1e-171 1..250 1..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 29532528..29532649 122 N° 2 29532260..29532434 175 N° 3 29532109..29532174 66 N° 4 29531868..29531916 49
N° 5 29531424..29531509 86 N° 6 29531255..29531334 80 N° 7 29531036..29531138 103 N° 8 29530843..29530901 59
N° 9 29530733..29530748 16  
complement(join(29530733..29530748,29530843..29530901,29531036..29531138,2953125 5..29531334,29531424..29531509,29531868..29531916,29532109..29532174,29532260..2 9532434,29532528..29532649))


exon

Literature and cross-references OsAPx02 (APX2 / APXb)
Literature Morita,S., Kaminaka,H., Masumura,T. and Tanaka,K. (2000) The expression of two cytosolic ascorbate peroxidase genes in rice. NCBI Direct Submission.
Protein ref. UniProtKB:   Q9FE01
DNA ref. GenBank:   NC_008400.1 (29532649..29530736)
Protein sequence: OsAPx02 (APX2 / APXb)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   26971.55  
PI (pH):   %s   5.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSKSYPTVSDEYLAAVGKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVSSRTGGPFGTMKNPGEQSHAANAGLDIAVRLLDPIKDQLPILSYADFYLAGVVAVEVTGGPEVPFHPGRQDKPEPPPEGRLPDATQGSDHLRQVFSAQMGLSDKDIVALSGGHTGRCHKERSGFEGAWTSNPLIFDNSYFTELVSGEKEGLLQLPSDKALMADPAFRPLVEKYADEDAFFADYAEAHLKLSELGFAEE

Retrieve as FASTA  
Remarks Complete sequence from 87 ESTs and 1 genomic (Chromo 7, 8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCAGCAAGTCGTACCCGACGGTGAGCGATGAGTACCTGGCGGCCGTGGGCAAGGCGAAGCGCAAGCTCCGCGGCCTCATCGCCGAGAAGAACTGCGCCCCACTCATGCTCCGCCTC
GC
GTAACTTTCTTCTTCTTCTTCTTCTACTGATTAATTTCCAGAAGATAGAGTAGGAGGAGTAGATGTTGAATTGCAGTGGCTGGCTGGCTGCAGGTGGCACTCTGCTGGCACCTTCGAT
GTGTCGTCGAGGACCGGCGGGCCCTTCGGCACCATGAAGAACCCCGGCGAGCAGTCCCACGCCGCCAACGCCGGCCTCGACATCGCCGTCAGGCTTCTCGACCCCATCAAGGACCAACTT
CCCATCCTCTCCTACGCCGACTTCTACCAG
GTAAGGTTCACTTCCCTCCCTTCCTCCCTTCCTTCCTCTCAACTCATCAACCTCTTAATTGGAGTCTCTCCCTCTCTATTGGCAGCTTGC
TGGCGTTGTGGCCGTCGAGGTCACCGGCGGACCTGAGGTCCCCTTCCATCCGGGCAGGCAG
GTCAGAATCACATTTCCCATCCCTAAACCCTCTCCCTCTCTCTCCCCCCTTCTTCTTTC
TTCTTCTGGTAGATGCAAATGGTATTTTTCTTAAGTCAATTCTTTTCTTTCGTCATCTTGTACGCCGCTGTTTCCTTTCCCTGAATTCTCCACTGTCTTGTGAATGTTGATGATGTGATG
TGTTTGTTTCTAGGACAAGCCTGAGCCTCCTCCTGAAGGCCGTCTTCCTGATGCCACACAAGGTATTAAGATTTCCTCTGTATTAAGTTACCCCTATGACAATGCATTTCCCAATGTGTT
GGTGATTAAATTTTCTAGATCTATGACCAGCATTTGTATGTGCTACTGATGGAGTAGTTCATATTGCAAGTCCATTACCAGAATTCTTTCATGCTTAAGTAAGTTGTGTAACCTACATAA
GACTAAAATTTTCCAACCCTGTTTATGCAAACCACATTACTAAAGTTTGTTTTGTGTTCCTGTTTATTCTTCTTTCTTATATGGAGCATACATGTTACCTGTGTGTTCTTTAATTAACAG
TGTGCCAATTTGTGGATGCGAGATAACTAATATGTCATGGTCTTCTGGCTGTTGGTCCAGGTTCTGACCACCTAAGGCAGGTCTTTTCTGCGCAGATGGGTTTGAGTGACAAGGACATAG
TTGCTCTTTCTGGTGGTCACACCCTG
GTTGGTACACTTGTGCAATTGCCCTAGTGTGTTTCTCATATCTTGTAACCGGAAGGGTTATTCATGCAGCTTCACTTCATCTTCTGTAGGGAAG
ATGCCACAAGGAGAGATCTGGCTTTGAGGGAGCCTGGACGTCCAACCCTTTGATCTTTGACAACTCTTACTTCAC
GTGCGTGATCTCTGATTCTTTTTAAAGATGCATCCTGTCTGTTGA
TAAACAGCCAGCCACAGCTTGTTTCCTTGTATGCTAAAGAATGAAAACCAAAATCTCCTCTCGATCAACAGCGAGCTTGTGAGTGGCGAGAAGGAAGGCCTTCTTCAGCTGCCAAGTGAC
AAAGCCCTCATGGCTGACCCAGCCTTCCGTCCACTGGTGGAGAAATATGCTGCG
GTACACCCCTTGATCCTTGCATTATTTTCTCTCGTCTTCTTTCTAAAGAGTTGTTTTTTTTAAAAT
AAAAGAAATAAGAGAAATGGATCATCGTTGATCTCTTAAAAAGTAGATGATTGTTGCCTGATATGTAGGATGAGGACGCCTTCTTTGCGGATTACGCCGAGGCCCACCTCAAGCTCTCTG
AACTGGG
GTAAGGGATGCAACTGGTGTGCTTGTCTGTGATGCGTTATTGGAGTGCTTTGTGCCAGAGTTTCACTAATTATTGTTGTGTTTGTGGGTTTCAGATTTGCTGAGGAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCAGCAAGTCGTACCCGACGGTGAGCGATGAGTACCTGGCGGCCGTGGGCAAGGCGAAGCGCAAGCTCCGCGGCCTCATCGCCGAGAAGAACTGCGCCCCACTCATGCTCCGCCTC
GC
GTGGCACTCTGCTGGCACCTTCGATGTGTCGTCGAGGACCGGCGGGCCCTTCGGCACCATGAAGAACCCCGGCGAGCAGTCCCACGCCGCCAACGCCGGCCTCGACATCGCCGTCAGG
CTTCTCGACCCCATCAAGGACCAACTTCCCATCCTCTCCTACGCCGACTTCTACCAG
CTTGCTGGCGTTGTGGCCGTCGAGGTCACCGGCGGACCTGAGGTCCCCTTCCATCCGGGCAGG
CAG
GACAAGCCTGAGCCTCCTCCTGAAGGCCGTCTTCCTGATGCCACACAAGGTTCTGACCACCTAAGGCAGGTCTTTTCTGCGCAGATGGGTTTGAGTGACAAGGACATAGTTGCTCTT
TCTGGTGGTCACACCCTG
GGAAGATGCCACAAGGAGAGATCTGGCTTTGAGGGAGCCTGGACGTCCAACCCTTTGATCTTTGACAACTCTTACTTCACCGAGCTTGTGAGTGGCGAGAAG
GAAGGCCTTCTTCAGCTGCCAAGTGACAAAGCCCTCATGGCTGACCCAGCCTTCCGTCCACTGGTGGAGAAATATGCTGCG
GATGAGGACGCCTTCTTTGCGGATTACGCCGAGGCCCAC
CTCAAGCTCTCTGAACTGGG
ATTTGCTGAGGAATAA

Retrieve as FASTA