Entry information : HaPrx19 (HanXRQChr15g0474421)
Entry ID 1875
Creation 2005-09-27 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx19 (HanXRQChr15g0474421)
Name (synonym) HaPrx19 (HanXRQChr15g0474421)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx19
start..stop
S start..stop
HaPrx16 543 0 10..327 12..331
LsaPrx27 498 3e-180 1..289 1..287
LsPrx27 498 3e-180 1..287 1..285
VvPrx24 491 1e-176 27..327 21..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38154911..38155355 445 N° 2 38155746..38156284 539  
join(38154911..38155355,38155746..38156284)


exon

Literature and cross-references HaPrx19 (HanXRQChr15g0474421)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L.,Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project
DNA ref. HanXRQ genome:   HanXRQChr15 (38154911..38156284)
EST ref. GenBank:   CD856013 [Fragment]
Cluster/Prediction ref. HanXRQ:   HanXRQChr15g0474421
Protein sequence: HaPrx19 (HanXRQChr15g0474421)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (302)
PWM (Da):   %s   36511.5 (33665.0)  
PI (pH):   %s   9.36 (9.22) Peptide Signal:   %s   cut: 26 range:26-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVRLNSLHLITYLTFTFLISSTHSQQLYTNFYQKSCPRFDQIMQETTTNKQINSPTTAAAALRLFFHDCLVEGCDGSILISSTHFSKAERDADINLSLPGDGFDVVVRAKTALELACPGVVSCSDILAVATRNLVTMMGGPFYTVKLGRRDGLVSRASRVNLPKPSMPMNQLIEIFTSRGFTIQEMVALSGAHTIGLSHCTEIRSDIYNYSRTSPIDPSLNRRYAEGLRSACADYRKNPSLSVFNDVMTPRNFDNAYFQNLPRGLGVLKSDRALVMDPRTRPFVELYARDQKAFFEAFGRAMEKLSLYGVKTGRRGEIRRRCDSFN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGTCAGACTAAACTCACTCCACCTCATCACATACCTCACATTCACATTCCTCATCTCCTCCACACACTCTCAACAACTCTACACAAACTTCTACCAGAAATCATGCCCTAGATTC
GACCAGATTATGCAGGAAACCACCACAAACAAACAAATCAACTCTCCGACCACCGCCGCCGCCGCTCTCCGCCTCTTTTTTCATGACTGCCTCGTCGAAGGCTGTGACGGATCTATATTA
ATCTCCTCCACACACTTCAGCAAAGCTGAACGTGATGCCGATATCAATTTATCCCTTCCTGGCGACGGTTTTGATGTCGTTGTTAGGGCGAAAACCGCTCTCGAACTCGCTTGTCCTGGT
GTCGTCTCCTGTTCAGATATCCTCGCTGTTGCTACTCGCAATCTTGTTACCATGATGGGCGGACCCTTCTACACCGTCAAATTAG
GTAAGATACTTTCTGTTGCGCCTAAAAAATAACGA
TTTCATCTAACACCCTGAAAGCATTTGGTACCAGGCACCGGTCGGTATGATACCGGGGACCGAATTATTTTTAGTACCGTATTGGTACCCGCTTTTTGTCGTTTTCGGACTGTACTTTTG
GTACATGTACCAGTTCGGTACCAGTATTTTACTGAATTTTTGCCTTCAATTACTGATAGTGTACTGAACATTTTTGGTACCGATACCAGTATTTGAAATGATTAAATCCGTTTTATAAAA
AATACAATGTGTAACATACAAATGTGTTAAAAACACAGATATAACTTAGTTACGTTAGTCTGAAAAACACAGATATAACTTAGTTACATTAGTCTGATCTGTTTTTTCAATCCAGGTCGT
AGAGACGGATTAGTTTCACGCGCCTCGCGCGTTAATCTACCTAAACCTTCAATGCCGATGAATCAACTGATTGAAATCTTCACATCTAGAGGCTTCACAATCCAGGAAATGGTGGCGTTA
TCCGGCGCTCACACAATCGGACTATCTCACTGTACGGAAATCAGATCTGATATCTACAACTACAGCCGGACGTCACCGATCGATCCGTCGTTGAACCGGCGGTACGCCGAGGGTTTGCGA
TCTGCGTGTGCGGATTACCGGAAAAATCCGTCCTTATCGGTGTTTAATGACGTCATGACGCCGAGAAACTTCGATAACGCGTATTTCCAGAACCTTCCGAGAGGTTTAGGAGTGTTGAAA
TCGGATCGGGCGTTGGTGATGGATCCGAGAACGAGGCCGTTTGTGGAGTTGTATGCGAGAGATCAGAAGGCGTTCTTCGAGGCGTTCGGTCGAGCGATGGAGAAGTTGAGTTTGTATGGT
GTGAAGACTGGCCGGAGAGGTGAAATCCGGCGCCGGTGTGATTCGTTTAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGTCAGACTAAACTCACTCCACCTCATCACATACCTCACATTCACATTCCTCATCTCCTCCACACACTCTCAACAACTCTACACAAACTTCTACCAGAAATCATGCCCTAGATTC
GACCAGATTATGCAGGAAACCACCACAAACAAACAAATCAACTCTCCGACCACCGCCGCCGCCGCTCTCCGCCTCTTTTTTCATGACTGCCTCGTCGAAGGCTGTGACGGATCTATATTA
ATCTCCTCCACACACTTCAGCAAAGCTGAACGTGATGCCGATATCAATTTATCCCTTCCTGGCGACGGTTTTGATGTCGTTGTTAGGGCGAAAACCGCTCTCGAACTCGCTTGTCCTGGT
GTCGTCTCCTGTTCAGATATCCTCGCTGTTGCTACTCGCAATCTTGTTACCATGATGGGCGGACCCTTCTACACCGTCAAATTAG
GTCGTAGAGACGGATTAGTTTCACGCGCCTCGCGC
GTTAATCTACCTAAACCTTCAATGCCGATGAATCAACTGATTGAAATCTTCACATCTAGAGGCTTCACAATCCAGGAAATGGTGGCGTTATCCGGCGCTCACACAATCGGACTATCTCAC
TGTACGGAAATCAGATCTGATATCTACAACTACAGCCGGACGTCACCGATCGATCCGTCGTTGAACCGGCGGTACGCCGAGGGTTTGCGATCTGCGTGTGCGGATTACCGGAAAAATCCG
TCCTTATCGGTGTTTAATGACGTCATGACGCCGAGAAACTTCGATAACGCGTATTTCCAGAACCTTCCGAGAGGTTTAGGAGTGTTGAAATCGGATCGGGCGTTGGTGATGGATCCGAGA
ACGAGGCCGTTTGTGGAGTTGTATGCGAGAGATCAGAAGGCGTTCTTCGAGGCGTTCGGTCGAGCGATGGAGAAGTTGAGTTTGTATGGTGTGAAGACTGGCCGGAGAGGTGAAATCCGG
CGCCGGTGTGATTCGTTTAATTAG

Retrieve as FASTA