Entry information : HaPrx20 (HanXRQChr10g0295811)
Entry ID 1876
Creation 2005-09-27 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx20 (HanXRQChr10g0295811)
Name (synonym) HaPrx20 (HanXRQChr10g0295811)
Class Class III peroxidase    [Orthogroup: Prx104]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx20
start..stop
S start..stop
HaPrx12 586 0 1..330 1..330
HaPrx37 565 0 1..330 1..334
HaPrx21 550 0 1..330 43..376
HaPrx[P]76 537 0 1..330 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 115963391..115963801 411 N° 2 115963120..115963282 163 N° 3 115962611..115963029 419  
complement(join(115962611..115963029,115963120..115963282,115963391..115963801))


exon

Literature and cross-references HaPrx20 (HanXRQChr10g0295811)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L.,
Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project
DNA ref. HanXRQ genome:   HanXRQChr10 (115963801..115962611)
EST ref. GenBank:   DY923732.1 [5' end]
Cluster/Prediction ref. HanXRQ:   HanXRQChr10g0295811
Protein sequence: HaPrx20 (HanXRQChr10g0295811)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (304)
PWM (Da):   %s   35201.04 (32491.5) Transmb domain:   %s   o10-29i
PI (pH):   %s   8.75 (8.75) Peptide Signal:   %s   cut: 27 range:27-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEASSLSKPLILLVLLLATLTNFALGQGYRGTRVGFYRSTCPRVESIVQSAVESAVQANPTIAPGLLRMFFHDCFINGCDASVLINGSSTEKSAGPNAFLRGFEVIDAAKSQLEKACPGVVSCSDILALAARDSVVLTGGHSWQVQLGRRDGLVSRASDTATLPAFNDPISVQIKKFADKGLNIQDLVTLVGGHTIGTASCATFSYRLYNFNNTNGPDPDINPSFLPQLRALCPNGGNGLTRVALDTGSVNSFGESFYANLRNGRGVIESDAKLWSDPTTQRFVQRFLGFRGLLGLRFDVEFGRAMVKMGNVGVKTGTQGEIRRVCTTTN

Retrieve as FASTA  
Remarks Complete sequence from genomic 1 EST, 5' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCTTCTTCCCTTAGCAAACCACTTATCTTGTTGGTTCTCCTGTTAGCCACACTCACAAACTTTGCACTAGGCCAAGGCTATAGAGGCACCCGAGTTGGCTTCTACAGGTCCACC
TGCCCTCGGGTGGAGTCCATAGTCCAATCTGCGGTTGAGTCTGCGGTCCAAGCCAACCCAACAATCGCACCTGGTTTACTACGGATGTTCTTCCATGACTGCTTTATCAATGGTTGTGAT
GCATCCGTACTAATTAACGGATCCTCAACTGAGAAGTCAGCAGGCCCAAACGCTTTTTTGAGAGGCTTTGAAGTTATTGATGCTGCAAAGTCCCAGCTCGAAAAGGCCTGCCCTGGAGTC
GTTTCTTGTTCTGATATTCTTGCCCTTGCTGCCCGTGATTCTGTCGTCCTG
GTAATAGTTTTCTAGTATAAATTATCCCAGTTTTCTAGTAGCGAAAAACATGTAGTTAATTAGTTGATT
AACCGTACGTTTTGTTTTGTTTTCTATGACTTGTTGCAGACGGGTGGGCATAGTTGGCAGGTGCAGTTAGGACGCAGAGACGGATTAGTTTCAAGAGCATCTGATACCGCAACCTTGCCA
GCCTTTAACGACCCTATTAGTGTGCAAATTAAAAAGTTTGCTGATAAAGGTCTTAACATTCAAGACCTTGTTACTCTTGTTG
GTAAGTAGAGCAAAATAACATTACTAAATGTAATTCAA
GGATGCTATTTTAATAATTATAAGTTAAACTGTTTATTTTTTTGTATCCCAGGTGGACACACAATTGGAACAGCATCTTGTGCAACATTCAGCTATAGATTATACAACTTCAACAACACC
AATGGACCCGACCCCGATATCAACCCATCATTCCTACCCCAGCTCCGAGCGCTTTGCCCCAATGGCGGTAATGGGCTGACGCGTGTGGCGCTTGATACAGGTAGCGTTAATAGCTTTGGT
GAGTCCTTCTACGCAAACCTAAGGAATGGACGTGGAGTTATTGAATCGGATGCAAAGCTATGGAGTGATCCAACAACACAAAGGTTTGTTCAACGGTTCCTGGGATTTCGGGGGCTACTT
GGATTGAGATTCGATGTTGAGTTTGGAAGAGCCATGGTGAAGATGGGTAATGTTGGGGTGAAGACAGGAACACAAGGTGAAATTCGTAGAGTTTGTACGACAACCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCTTCTTCCCTTAGCAAACCACTTATCTTGTTGGTTCTCCTGTTAGCCACACTCACAAACTTTGCACTAGGCCAAGGCTATAGAGGCACCCGAGTTGGCTTCTACAGGTCCACC
TGCCCTCGGGTGGAGTCCATAGTCCAATCTGCGGTTGAGTCTGCGGTCCAAGCCAACCCAACAATCGCACCTGGTTTACTACGGATGTTCTTCCATGACTGCTTTATCAATGGTTGTGAT
GCATCCGTACTAATTAACGGATCCTCAACTGAGAAGTCAGCAGGCCCAAACGCTTTTTTGAGAGGCTTTGAAGTTATTGATGCTGCAAAGTCCCAGCTCGAAAAGGCCTGCCCTGGAGTC
GTTTCTTGTTCTGATATTCTTGCCCTTGCTGCCCGTGATTCTGTCGTCCTG
ACGGGTGGGCATAGTTGGCAGGTGCAGTTAGGACGCAGAGACGGATTAGTTTCAAGAGCATCTGATACC
GCAACCTTGCCAGCCTTTAACGACCCTATTAGTGTGCAAATTAAAAAGTTTGCTGATAAAGGTCTTAACATTCAAGACCTTGTTACTCTTGTTG
GTGGACACACAATTGGAACAGCATCT
TGTGCAACATTCAGCTATAGATTATACAACTTCAACAACACCAATGGACCCGACCCCGATATCAACCCATCATTCCTACCCCAGCTCCGAGCGCTTTGCCCCAATGGCGGTAATGGGCTG
ACGCGTGTGGCGCTTGATACAGGTAGCGTTAATAGCTTTGGTGAGTCCTTCTACGCAAACCTAAGGAATGGACGTGGAGTTATTGAATCGGATGCAAAGCTATGGAGTGATCCAACAACA
CAAAGGTTTGTTCAACGGTTCCTGGGATTTCGGGGGCTACTTGGATTGAGATTCGATGTTGAGTTTGGAAGAGCCATGGTGAAGATGGGTAATGTTGGGGTGAAGACAGGAACACAAGGT
GAAATTCGTAGAGTTTGTACGACAACCAATTGA

Retrieve as FASTA