Entry information : HaPrx21 (HanXRQChr10g0296231)
Entry ID 1877
Creation 2005-09-27 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx21 (HanXRQChr10g0296231)
Name (synonym) HaPrx21 (HanXRQChr10g0296231)
Class Class III peroxidase    [Orthogroup: Prx104]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx21
start..stop
S start..stop
HaPrx[P]76 626 0 43..376 1..334
HaPrx13 555 0 78..376 36..331
HaPrx20 553 0 43..376 1..330
LsaPrx11 546 0 78..376 33..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 117673559..117674107 549 N° 2 117673283..117673445 163 N° 3 117672769..117673187 419  
complement(join(117672769..117673187,117673283..117673445,117673559..117674107))


exon

Literature and cross-references HaPrx21 (HanXRQChr10g0296231)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L.,
Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project
DNA ref. HanXRQ genome:   HanXRQChr10 (117674107..117672769)
EST ref. GenBank:   AJ540201.1 [3' end]
Cluster/Prediction ref. HanXRQ:   HanXRQChr10g0296231
Protein sequence: HaPrx21 (HanXRQChr10g0296231)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   377
PWM (Da):   %s   40399.71  
PI (pH):   %s   9.13
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVDFQSPTKTIYTDPPCNVSTSTSHLRNTLLNLKDKSLLLLLMEISSLSKTVALLVLLLATLTTLSLGQGNRGSGSGTRLGYYRSSCPRAESIVQSAVRPAVQANPTIAPGLLRMFFHDCFVNGCDASILIDGPTTEKSAGPNSLLRGFEVIDAAKSQLETACPGVVSCADIVALAARDSVVLTGGRSWQVRLGRRDGLVSQASDTANLPAFNDPISVQIRKFADKGLNTQDLVTLVGGHTIGTAACALFSYRLYNFNNTNGPDPDINPAFLPQLRALCPNGGDALRRVALDTGSDNSFGNSFYENLRNGRGVIESDAKLWSDRRTQRFVQRYLGGRGQIGSRFNAEFGRAMVKMGNIEVKTGTQGEIRRVCTATN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGACTTTCAATCTCCCACAAAGACTATATATACCGACCCTCCATGCAATGTCTCAACATCAACATCTCATTTACGAAATACATTACTTAACCTCAAAGACAAATCCTTGTTATTG
TTACTAATGGAGATTTCCTCCTTAAGCAAAACGGTTGCTTTGTTGGTTCTTCTGTTAGCCACTCTCACAACCTTGTCACTAGGTCAAGGCAACCGCGGTAGTGGCAGCGGCACCCGTCTT
GGTTATTACAGGTCGTCCTGCCCTAGGGCCGAATCCATAGTTCAGTCTGCGGTTCGGCCTGCTGTCCAAGCCAACCCAACAATCGCACCTGGTTTACTAAGGATGTTCTTCCATGACTGC
TTTGTCAATGGTTGTGATGCATCTATACTAATTGATGGACCCACAACTGAGAAGTCAGCAGGCCCAAACTCTCTCTTGAGAGGCTTTGAAGTTATTGATGCTGCAAAGTCCCAGCTCGAA
ACAGCCTGCCCAGGAGTGGTCTCATGTGCTGATATCGTTGCTCTTGCTGCACGTGATTCTGTGGTCTTG
GTAAGTAGATATTTCCTTAACAGTTAACCCTAGCTTCTCATGCTGATTGTA
CATTAGAAACTTGTAGTTATATATGCTTATTGGTTAATCATTTTTTTGATATATTATTGCAGACCGGTGGACGTAGTTGGCAGGTACGATTAGGACGTAGAGATGGATTGGTTTCACAAG
CATCGGATACCGCAAACTTGCCTGCCTTTAATGACCCTATTAGTGTCCAAATCCGAAAGTTTGCTGATAAAGGCCTCAACACCCAAGATCTTGTTACTCTTGTCG
GTAAGTAGAGCAAAA
AAATGTACAGCAACTACTTCACATATAGAATGTTATGGCTATAAAAATAATTAAACCTTGTGACTTATTTTTATTTAAAGGTGGACACACTATTGGAACAGCAGCATGTGCATTATTCAG
CTACAGGTTATACAACTTCAACAATACCAATGGACCCGACCCAGATATAAACCCAGCATTCCTACCACAGCTCCGAGCACTTTGCCCCAATGGTGGCGATGCATTAAGACGTGTGGCGCT
TGATACAGGTAGCGATAATAGTTTCGGCAATTCATTCTATGAAAACTTGAGGAATGGAAGGGGAGTTATTGAATCCGATGCAAAGCTATGGAGTGACCGCAGGACTCAGAGGTTTGTACA
AAGGTATTTGGGGGGAAGGGGGCAAATTGGATCGAGATTTAACGCAGAGTTTGGAAGAGCAATGGTGAAGATGGGTAATATTGAGGTGAAAACAGGGACACAAGGTGAAATTCGTAGAGT
GTGTACTGCAACCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGACTTTCAATCTCCCACAAAGACTATATATACCGACCCTCCATGCAATGTCTCAACATCAACATCTCATTTACGAAATACATTACTTAACCTCAAAGACAAATCCTTGTTATTG
TTACTAATGGAGATTTCCTCCTTAAGCAAAACGGTTGCTTTGTTGGTTCTTCTGTTAGCCACTCTCACAACCTTGTCACTAGGTCAAGGCAACCGCGGTAGTGGCAGCGGCACCCGTCTT
GGTTATTACAGGTCGTCCTGCCCTAGGGCCGAATCCATAGTTCAGTCTGCGGTTCGGCCTGCTGTCCAAGCCAACCCAACAATCGCACCTGGTTTACTAAGGATGTTCTTCCATGACTGC
TTTGTCAATGGTTGTGATGCATCTATACTAATTGATGGACCCACAACTGAGAAGTCAGCAGGCCCAAACTCTCTCTTGAGAGGCTTTGAAGTTATTGATGCTGCAAAGTCCCAGCTCGAA
ACAGCCTGCCCAGGAGTGGTCTCATGTGCTGATATCGTTGCTCTTGCTGCACGTGATTCTGTGGTCTTG
ACCGGTGGACGTAGTTGGCAGGTACGATTAGGACGTAGAGATGGATTGGTT
TCACAAGCATCGGATACCGCAAACTTGCCTGCCTTTAATGACCCTATTAGTGTCCAAATCCGAAAGTTTGCTGATAAAGGCCTCAACACCCAAGATCTTGTTACTCTTGTCG
GTGGACAC
ACTATTGGAACAGCAGCATGTGCATTATTCAGCTACAGGTTATACAACTTCAACAATACCAATGGACCCGACCCAGATATAAACCCAGCATTCCTACCACAGCTCCGAGCACTTTGCCCC
AATGGTGGCGATGCATTAAGACGTGTGGCGCTTGATACAGGTAGCGATAATAGTTTCGGCAATTCATTCTATGAAAACTTGAGGAATGGAAGGGGAGTTATTGAATCCGATGCAAAGCTA
TGGAGTGACCGCAGGACTCAGAGGTTTGTACAAAGGTATTTGGGGGGAAGGGGGCAAATTGGATCGAGATTTAACGCAGAGTTTGGAAGAGCAATGGTGAAGATGGGTAATATTGAGGTG
AAAACAGGGACACAAGGTGAAATTCGTAGAGTGTGTACTGCAACCAATTGA

Retrieve as FASTA