Entry information : HaPrx23 ( HanXRQChr15g0469051)
Entry ID 1879
Creation 2005-09-27 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx23 ( HanXRQChr15g0469051)
Name (synonym) HaPrx23 ( HanXRQChr15g0469051)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx23
start..stop
S start..stop
HarPrx11 627 0 1..316 1..316
LsPrx17 566 0 7..316 8..316
LsaPrx17 564 0 7..316 8..316
LsePrx17 543 0 7..316 8..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16927019..16927222 204 N° 2 16926739..16926927 189 N° 3 16926239..16926404 166 N° 4 16925731..16926122 392
complement(join(16925731..16926122,16926239..16926404,16926739..16926927,1692701 9..16927222))


exon

Literature and cross-references HaPrx23 ( HanXRQChr15g0469051)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L.,Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project
DNA ref. HanXRQ genome:   HanXRQChr15 (16927222..16925731)
Cluster/Prediction ref. HanXRQ:   HanXRQChr15g0469051 UniGene:   Han.2245 [3' end]
Protein sequence: HaPrx23 ( HanXRQChr15g0469051)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (294)
PWM (Da):   %s   35040.16 (32482.8)  
PI (pH):   %s   6.65 (5.73) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRFDAIMKVVVMLVIMLRHCNGLSMNYYMLSCPMAEFIVRNSVNSALRADPTLAAGLLRMHFHDCFIEGCDASILLDSTDDNTAEKDSPANLSLRGYEVIDDAKQQLENQCPGVVSCADIVAMAARDAVLFSAPGLIYDIPKGRKDGTRSKIEDTRNLPPPIFNSSELIKMFGQKGFTAQEMVALSGGHTLGVARCSAFKNRLKNFDSTHDVDPNMDTQFMKTLVKTCSAGDTAEQPFDATRNNFDNAYYRALQRQAGLLTSDQTLMTDPNTRPIVNAYAMNQAMFFFDFQRAMVKMGQLDVKETGQVRQNCRKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGATTTGATGCTATCATGAAAGTGGTGGTAATGCTAGTGATCATGCTAAGACATTGTAACGGTCTTAGCATGAACTACTACATGTTGAGTTGCCCTATGGCCGAGTTCATTGTTAGA
AACTCGGTCAACTCAGCTTTGAGAGCCGACCCAACACTCGCTGCGGGTCTTCTCAGGATGCACTTCCATGATTGTTTCATTGAG
GTACTCGGTTTGTCTTTTGTTCGTGTAACTCTACTT
ATGTTTTATGTTTTGTCCTCATTTAATCTTTAAAAATTGCATGTTTTACATGTAGGGTTGTGATGCATCCATTTTGCTTGATTCTACGGATGACAACACGGCGGAGAAAGATTCTCCCGC
GAATTTGAGCTTGAGGGGCTACGAGGTCATCGACGATGCCAAACAACAACTTGAAAACCAGTGCCCTGGTGTCGTGTCATGTGCCGATATTGTAGCAATGGCTGCCCGTGATGCGGTTCT
CTTT
GTAAGTACACATATACTTAAATCCAATTTAATACATATATACACATAATTCACACGCTCATTTCAGAACCAATAATTATATTGAGAAGTGCTAGAATCACGTAATGAAATTTTACC
ATTTGCTTTAAGTGTAATACAATATAACACATATATCTACCCCCAATATCTTTCTTTCTCTAATAAATCATCAATGAGCTACGTACAAGTGTTATATGTTGTTGTCGCAGTTCTCAACAT
AATATTGGTTCTGAAAAGAATGTGTTCCTATGTATACATATATATATACGGACATGTCAGGTTTATGTGATATTGACACGTCATTTGCAATCGTGTAGAGCGCTCCGGGTCTAATTTATG
ATATACCAAAAGGAAGAAAAGATGGAACAAGATCCAAAATTGAAGACACAAGAAACTTGCCTCCACCAATCTTCAACAGCAGTGAACTAATTAAAATGTTTGGGCAAAAGGGTTTCACAG
CTCAAGAAATGGTTGCCCTTTCTG
GTACACTTTTTATTTTTATAAAAAAAAAAGATATTAATTAATATCATAAAAATCTAATACAATTTGATAAGTTTTTTCACTCAAAAGGGTTAAATG
GACTAACATTGGTCATGTAGGTGGACATACACTAGGAGTGGCTCGATGTTCCGCGTTCAAGAACCGTCTAAAAAACTTTGACTCGACACATGATGTGGACCCGAACATGGACACCCAGTT
CATGAAAACGCTAGTGAAGACATGTAGCGCTGGAGACACTGCGGAACAACCATTTGACGCGACAAGAAACAATTTTGATAATGCGTACTACAGGGCGCTTCAAAGGCAGGCGGGACTCCT
GACATCGGACCAAACCTTGATGACTGATCCCAATACCCGGCCCATTGTCAACGCATACGCGATGAACCAAGCCATGTTCTTTTTCGATTTTCAACGAGCCATGGTGAAGATGGGGCAGCT
TGATGTTAAAGAGACCGGACAAGTTCGCCAAAACTGCCGCAAAATCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGATTTGATGCTATCATGAAAGTGGTGGTAATGCTAGTGATCATGCTAAGACATTGTAACGGTCTTAGCATGAACTACTACATGTTGAGTTGCCCTATGGCCGAGTTCATTGTTAGA
AACTCGGTCAACTCAGCTTTGAGAGCCGACCCAACACTCGCTGCGGGTCTTCTCAGGATGCACTTCCATGATTGTTTCATTGAG
GGTTGTGATGCATCCATTTTGCTTGATTCTACGGAT
GACAACACGGCGGAGAAAGATTCTCCCGCGAATTTGAGCTTGAGGGGCTACGAGGTCATCGACGATGCCAAACAACAACTTGAAAACCAGTGCCCTGGTGTCGTGTCATGTGCCGATATT
GTAGCAATGGCTGCCCGTGATGCGGTTCTCTTT
AGCGCTCCGGGTCTAATTTATGATATACCAAAAGGAAGAAAAGATGGAACAAGATCCAAAATTGAAGACACAAGAAACTTGCCTCCA
CCAATCTTCAACAGCAGTGAACTAATTAAAATGTTTGGGCAAAAGGGTTTCACAGCTCAAGAAATGGTTGCCCTTTCTG
GTGGACATACACTAGGAGTGGCTCGATGTTCCGCGTTCAAG
AACCGTCTAAAAAACTTTGACTCGACACATGATGTGGACCCGAACATGGACACCCAGTTCATGAAAACGCTAGTGAAGACATGTAGCGCTGGAGACACTGCGGAACAACCATTTGACGCG
ACAAGAAACAATTTTGATAATGCGTACTACAGGGCGCTTCAAAGGCAGGCGGGACTCCTGACATCGGACCAAACCTTGATGACTGATCCCAATACCCGGCCCATTGTCAACGCATACGCG
ATGAACCAAGCCATGTTCTTTTTCGATTTTCAACGAGCCATGGTGAAGATGGGGCAGCTTGATGTTAAAGAGACCGGACAAGTTCGCCAAAACTGCCGCAAAATCAACTAA

Retrieve as FASTA