Entry information : AtAPx02 (At3g09640 / APX1B / APX2)
Entry ID 1888
Creation 2006-09-04 (Christophe Dunand)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-15 (Christophe Dunand)
Peroxidase information: AtAPx02 (At3g09640 / APX1B / APX2)
Name (synonym) AtAPx02 (At3g09640 / APX1B / APX2)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation Cytosolic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtAPx02
start..stop
S start..stop
AhalAPx07 502 0 1..251 1..251
AlyAPx02 496 0 1..251 1..251
CagraAPx02 490 6e-179 1..251 1..251
BstrAPx02 489 1e-178 1..251 1..251
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2956301..2956422 122 N° 2 2956524..2956698 175 N° 3 2957050..2957115 66 N° 4 2957258..2957306 49
N° 5 2957387..2957469 83 N° 6 2957546..2957625 80 N° 7 2957717..2957819 103 N° 8 2957909..2957967 59
N° 9 2958145..2958163 19  
join(2956301..2956422,2956524..2956698,2957050..2957115,2957258..2957306,2957387 ..2957469,2957546..2957625,2957717..2957819,2957909..2957967,2958145..2958163)


exon

Literature and cross-references AtAPx02 (At3g09640 / APX1B / APX2)
Protein ref. UniProtKB:   Q67XB1
DNA ref. Phytozome 12:   Chr3 (2956301..2958163)
mRNA ref. GenBank:   AK176908
Cluster/Prediction ref. Phytozome Gene 12:   19660573 UniGene:   At.129
Omic ref. AtProteome:   At3g09640 ATTED-II:   At3g09640 e-FP Browser:   At3g09640 ePlant:   At3g09640 TAIR:   At3g09640
Protein sequence: AtAPx02 (At3g09640 / APX1B / APX2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   27859.48  
PI (pH):   %s   6.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKKSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYADEDAFFEDYTEAHLKLSELGFADKE

Retrieve as FASTA  
Remarks Complete sequence from 4 cDNAs, 2 ESTs, and 1 genomic sequence (chromo 3, 8 introns).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGAAGCTGTG GAGAAGACCT CAGCTGCGAT CAAGGTTTTG AAACAGATCG GTGCTTATGA TGATGCTGAG AAGGCAAAGA ACAGCATTGG AATCCGTCCT GGTAAAGGTA AAATGAGGAA  CCGTCGTTAC ATTTCTAGGA AAGGTCCTCT GGTGGTTTAT GGAACTGAAG GATCTAAGAT AGTTAAGGCG TTTAGAAACC TTCCTGGTGT TGAGCTTTGT CATGTGGAGA GGCTTAATTT  GTTGAAGCTT GCTCCTGGTG GTCACCTTGG TCGGTTTGTG ATCTGGACCA AGTCTGCCTT TGAGAAGCTT GAGTCTATCT ATGGTTCGTT TGAGAAGCCA TCAGAGAAGA AGAAGGGGTA  TGTGCTTCCT CGTGCAAAGA TGGTGAATGC TGATCTTGCC AGGATTATCA ATTCAGATGA GATTCAGAGT GTTGTGAATC CGATCAAGAA GGATGCGAAG AGGGCTGTTC TTAAGAAGAA  TCCATTGAAG AATCTCAATG TGATGTTGAA GTTGAATCCT TATGCTAAGA CCGCGAAGAG GATGTCACTG TTAGCTGAAG CACAGAGAGT TAAGGCTAAG AAGGAGAAGC TCGCCAAGAA  GAGGAAAACC GTTACCAAGG TAATCTCAAT ACTTGACTTG TTCTCTTATC AACCGTTTTT GGATTGTCTT TGTTTAGTTA CTGATTACAT TTTGATCTGT GGTTGCATTT CATTTGACTT  AACTTATATT GCAATTGTTC TAATTGACTG AGTTTGTGTA TGTTAAGCTA TACAATAATC TGTTCCCCTC TGGTTTAGTC TATGACTATA GTAGTCTTTC TTTACTAGAT CTTACCTTTT  CTGTTCTGAA TTGTGGTCTA GTAGTTTGTC TTGTAAATCT GTTGTGTACG ATTCTTTGTC TTGATATTGA TTTTAGGTTG AGCTATTAAG CAATTGAATC TCTTAGCACT TTCTTGTCCC  TTGTGAAAAT TGTTCTTCAT ATGTCCTCTT TTCTAACTCC ACTTTGAAAT ATCTATTTTT CTTACATCAG GAGGAGGCGT TGGCAATCAA AGCAGCAGGC AAGTCGTGGT ACAAGACTAT  GATCTCCGAC AGTGATTACA CCGAGTTTGA TAACTTCACC AAATGGCTCG GTGCTAGCCA GTAATAATCT CGTCTGCTTT GGAACACTTT CCATATTTTA GTCAAAAGAT TTTGGTTTTT  TTAATCTGTT TTGTCTTTGG GTGTCTGGAT ATCAAGTTGA ATTATGAACA AGTTTCACTT TTTTACATCT CCATTTCTTA CTTCGCCTTT ATCAGTTTCA TTTATTTATC TCTTGCTCCT  TCGTTTCCTA TGATGATGCT TGTTATGTTA TGAACCTACT TAAAAACAAG CTGAAGCTTT CTTTGGTTTA CCCCAGCAGA AACATTAATC AAGTTCAATT GATCAATATG TCGATTGATT  TACTGTTTAA AGGCATAGTG TGTCTATCAA CCCTTAAGTC TTTTTGGTGG ATAGTGAAGC TCAAACCCAA TTCAAATGTC GATCAACCCT AACGTTTTTG TGCTCGATAG TAAAGCATGA  GTATAAAAAG AACGTCGCTT CTTCCTACAA TCACACAGAT CATTTGAAGC TTTGATTAGT TGGTACAACA TACTCGAGGA ATACAGAATG ACACGTGGTG TGTATCTGTT GGATAAATTT  GTATTATTCT TCTTTACTAT GGATGGTTTC TGGAAGGCGC GCCAAGAGTC CTTCTTTTTC CATCTACAAA TCATGACCGT CCATCTCCAA AAGAAGACTG AAACAGTGAA ACTAGAAGCT  TCATTTTGAT CATCAGCCAG TTTTATAAAT TGATCCGTAT ACTAAAGTAA CAACTACTAG CACTTTCTTC TGTGATCGAT CATTGTGTTT AAACTAAAGG TTTGTATGTT CTTGTAATCT 
TATTGATCTC GATAGGTTCT CCATTCTCTT TAGGTTTTAA AGCCTTCAAC GATTTCCAGA AGGAAGCGAA TTTGAAAAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCTGGAATCT GGTGTCATCT CCTACCTCCT TGATTCTTGT TCCCTCACAT TATTATTGTA ATCATAGAAA ATACTTTAAA AATTAAATGG AAGACATTGT ATTATACGTA TGCCTTGCGT  TTTTTGTAAT TGTTAATTAA TGAAATAAGA GCACTTGCTT GCTGAAACTA AAAAACTCTT ACAACAATTC ATTACCTTCA TATAGTTTGA AGGCTAGTAA TCTCACAATG ATAAACTATA  TTGAAAGTTG TGTTATCGTT GAAAAATTAA AATAATTTTT ATTTCTGTAT CTTCAATGAT GGTAAACAAA TGAAAGCTTC AAAGTTTATT TTTGTAAATT CGGAAAACGA ATGATATTAT  TGTCTACAAT TTCTTCAAAT CATCATTATA ATTGTTTTGC TCTTTTGAAA AAATAAAATG GAGATATTAA TTTGCTTGAA CTCAAAACGA CGACGTAGCA CAACTCCTTT CCACTCGAAT  AATCCATTTG GAGGCTTTTT TTCATTACAG AACACACACT CTCTCTCCAA TGGACCTAAA ATGAACATTC TCCGACCTCC GACGTCATCA TCATCTTCGT CGTTTCCTCC ATACCCAAAG  CCCGTTTCAT TAACCCCTCC GGTATCTTTC ACTCTCATCC ACAACCCCAT AAACCTCTGC TCTATAAACC CACCATTCAC CAACGCTGGT CGACCAATTT TCCAACGGTC CGCCTCCGGC  ACTGCTAATA GCTCCGCCGA AGACCTCTCG TCTTTCTTGG GCTCTCCCTC AGAGGCGTAT TCAACACACA ACGACCAAGA GCTTTTGTTT CTCCTCCGCA ATAGAAAAAC CGATGAAGCT  TGGGCTAAGT ATGTTCAATC CACTCATCTC CCTGGACCAA CTTGTCTTAG CCGTTTAGTT TCTCAATTAT CTTATCAATC CAAACCCGAG AGTCTCACGC GCGCACAATC TATCCTCACG 
CGCCTCCGCA ATGAACGCCA GCTGCATCGC CTTGACGCTA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGAAGAGTTACCCGGAAGTGAAAGAAGAGTACAAGAAAGCTGTTCAGAGATGCAAGAGGAAGCTCCGTGGTCTTATTGCCGAGAAGCACTGTGCTCCCATCGTCCTCCGTCTT
GC
GTAAGATCCTCTCTCTGGTTCCAGTCTTTTCTGTTACTGTGAGTACTGAGTTGTTCGATTGATGGCTTCTCAGAGCATATTTTGTTGGCGGAAATTTGCAGATGGCACTCGGCTGGGA
CATTTGATGTGAAGACGAAGACAGGAGGACCGTTTGGGACGATAAGGCATCCCCAAGAGCTAGCCCATGATGCCAACAATGGTCTTGATATTGCCGTTAGGCTTCTTGACCCTATCAAGG
AGCTGTTCCCTATTCTGTCATATGCTGACTTCTACCAG
GTAAATTTTCAACAATGTACTGAGTTTTTTGACCTCTAATTGTGAAGCAAGGGATGCATCAAGCTGTAGTAAGTAGGAACTT
GAGGTAGAACCATAGAATCAAGGGTTTTTTGATGCATCAGTGATTATACCGAGAGGGGAAACATTTGGAAGGGATTTTGTTGGTTGGTACAGCTAAGTTATGACTTAAAATGGGTTCTTC
TCTAGCTTGAGCCGTCGGCTATTGGCCCTCTGGTTTGTCTGCAGTGAACTAGATTCACACATGTTAGATTGATACTGAATCTAAAAGCTTACTTTGTATTTCGCATGGCTTTAAGGGCTT
GATTCATCTGTGTTTCTTGGTTACTGTAGCTAGCTGGAGTAGTTGCTGTTGAGATCACTGGAGGACCAGAGATTCCATTTCATCCTGGTAGACTGGTGAGTCAATATTCAACTTCTCAGT
TTTCTGGCTACCAATTATTAGCTATCTCTTCGTTTTAAAACGCAACTCACTGATGATGAGACACCACTGCTAAGTTTTTTGTTCATGTGATTAACTGAACCAAACTTCATCTTTCAGGAC
AAAGTTGAGCCACCTCCTGAAGGTCGTCTGCCTCAGGCCACCAAAG
GTAAAGCAGATATATGAAAATGAATTTAGCTTGAATTCAGGTATCAGATTGTAGATACATGTTCATAATCATAA
ATTCAGGTGTGGATCATCTAAGAGATGTGTTTGGTCGGATGGGACTCAATGACAAAGATATCGTTGCATTGTCTGGTGGACACACCTTGGTATGTATGCTGCATCCAGAAACAAAGACCT
ATGTGCTTTTCTCAGTTCTGGCTCACACCATTCTTTTACTTTCAGGGTCGGTGCCACAAGGAGCGTTCAGGATTCGAGGGTGCATGGACACCAAACCCGCTCATTTTTGACAACTCCTAT
TTCAA
GTAAGATCAGATTCTCTGCTTCTGCTTGCTCATACTTGAATTGGACATGAGCTGAATTAGAAGCTCTTGAATCTTGATGGTTGTTAAACAGAGAGATACTAAGCGGAGAGAAAGA
AGGACTTCTTCAACTACCAACCGACAAGGCTCTTCTTGATGATCCTCTCTTTCTCCCATTTGTTGAAAAATATGCTGCA
GTAAGTTGTTCAACTCATCATTCCATGATTCTCTCAGCATA
CATATATTGTCAATAGGATAATATCACTGACTGGATTGTTACTCTCAGGATGAGGATGCCTTCTTCGAAGACTATACGGAAGCTCATCTAAAGTTGTCAGAACTCGGGTAAGTAACATAT
AGAACAATCATTCTCATCAACATTTTATTTAACTTTCTTTCCTATTCTCCTAATGTAGTGTCGTAAACTTTGAATGGTCCTCAGAAACTCACAAAAACTTTTCATTTGCAAACACTTTGA
TCATAATAACATAACTTACGCTCATGTCATCATGTCCTTTGCAGGTTTGCTGACAAGGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGAAGAGTTACCCGGAAGTGAAAGAAGAGTACAAGAAAGCTGTTCAGAGATGCAAGAGGAAGCTCCGTGGTCTTATTGCCGAGAAGCACTGTGCTCCCATCGTCCTCCGTCTT
GC
ATGGCACTCGGCTGGGACATTTGATGTGAAGACGAAGACAGGAGGACCGTTTGGGACGATAAGGCATCCCCAAGAGCTAGCCCATGATGCCAACAATGGTCTTGATATTGCCGTTAGG
CTTCTTGACCCTATCAAGGAGCTGTTCCCTATTCTGTCATATGCTGACTTCTACCAG
CTAGCTGGAGTAGTTGCTGTTGAGATCACTGGAGGACCAGAGATTCCATTTCATCCTGGTAGA
CTG
GACAAAGTTGAGCCACCTCCTGAAGGTCGTCTGCCTCAGGCCACCAAAGGTGTGGATCATCTAAGAGATGTGTTTGGTCGGATGGGACTCAATGACAAAGATATCGTTGCATTGTCT
GGTGGACACACCTTG
GGTCGGTGCCACAAGGAGCGTTCAGGATTCGAGGGTGCATGGACACCAAACCCGCTCATTTTTGACAACTCCTATTTCAAAGAGATACTAAGCGGAGAGAAAGAA
GGACTTCTTCAACTACCAACCGACAAGGCTCTTCTTGATGATCCTCTCTTTCTCCCATTTGTTGAAAAATATGCTGCA
GATGAGGATGCCTTCTTCGAAGACTATACGGAAGCTCATCTA
AAGTTGTCAGAACTCGG
GTTTGCTGACAAGGAGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACTAGCACTT TCTTCTGTGA TCGATCATTG TGTTTAAACT AAAGGTTTGT ATGTTCTTGT AATCTTATTG ATCTCGATAG GTTCTCCATT CTCTTTAGGT TTTAAAGCCT TCAACGATTT  CCAGAAGGAA GCGAATTTGA AAAAAATGGT GAAGAAGAGT TACCCGGAAG TGAAAGAAGA GTACAAGAAA GCTGTTCAGA GATGCAAGAG GAAGCTCCGT GGTCTTATTG CCGAGAAGCA  CTGTGCTCCC ATCGTCCTCC GTCTTGCATG GCACTCGGCT GGGACATTTG ATGTGAAGAC GAAGACAGGA GGACCGTTTG GGACGATAAG GCATCCCCAA GAGCTAGCCC ATGATGCCAA  CAATGGTCTT GATATTGCCG TTAGGCTTCT TGACCCTATC AAGGAGCTGT TCCCTATTCT GTCATATGCT GACTTCTACC AGCTAGCTGG AGTAGTTGCT GTTGAGATCA CTGGAGGACC  AGAGATTCCA TTTCATCCTG GTAGACTGGA CAAAGTTGAG CCACCTCCTG AAGGTCGTCT GCCTCAGGCC ACCAAAGGTG TGGATCATCT AAGAGATGTG TTTGGTCGGA TGGGACTCAA  TGACAAAGAT ATCGTTGCAT TGTCTGGTGG ACACACCTTG GGTCGGTGCC ACAAGGAGCG TTCAGGATTC GAGGGTGCAT GGACACCAAA CCCGCTCATT TTTGACAACT CCTATTTCAA  AGAGATACTA AGCGGAGAGA AAGAAGGACT TCTTCAACTA CCAACCGACA AGGCTCTTCT TGATGATCCT CTCTTTCTCC CATTTGTTGA AAAATATGCT GCAGATGAGG ATGCCTTCTT  CGAAGACTAT ACGGAAGCTC ATCTAAAGTT GTCAGAACTC GGGTTTGCTG ACAAGGAGTA ATCTGGAATC TGGTGTCATC TCCTACCTCC TTGATTCTTG TTCCCTCACA TTATTATTGT 
AATCATAGAA AATACTTTAA AAATTAAATG GAAGACATTG TATTATACGT ATGCCTTGCG TTTTTTGTAA TTGTTAATTA ATGAAATAAG AGCACTTGCT TGCTG 

Retrieve as FASTA