Entry information : AtAPx01 (At1g07890 / APX1 / CS1 / MATERNAL_EFFECT_EMBRYO_ARREST 6 / MEE6)
Entry ID 1890
Creation 2006-09-04 (Christophe Dunand)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-15 (Christophe Dunand)
Peroxidase information: AtAPx01 (At1g07890 / APX1 / CS1 / MATERNAL_EFFECT_EMBRYO_ARREST 6 / MEE6)
Name (synonym) AtAPx01 (At1g07890 / APX1 / CS1 / MATERNAL_EFFECT_EMBRYO_ARREST 6 / MEE6)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation Cytosolic
Tissue types Flower buds
Flowers
Leaves
Radicles
Roots
Seedlings
Seeds
Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtAPx01
start..stop
S start..stop
AhalAPx02 514 0 1..250 1..250
AlyAPx01 514 0 1..250 1..250
CagraAPx01 507 0 1..250 1..250
TparAPx01 503 0 1..250 1..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2438005..2438123 119 N° 2 2438211..2438385 175 N° 3 2438491..2438556 66 N° 4 2438709..2438843 135
N° 5 2438935..2439014 80 N° 6 2439088..2439190 103 N° 7 2439278..2439336 59 N° 8 2439420..2439435 16
join(2438005..2438123,2438211..2438385,2438491..2438556,2438709..2438843,2438935 ..2439014,2439088..2439190,2439278..2439336,2439420..2439435)


exon

Literature and cross-references AtAPx01 (At1g07890 / APX1 / CS1 / MATERNAL_EFFECT_EMBRYO_ARREST 6 / MEE6)
Literature Kubo,A., Saji,H., Tanaka,K., Tanaka,K. and Kondo,N. (1992) Cloning and sequencing of a cDNA encoding ascorbate peroxidase from Arabidopsis thaliana. Plant Mol. Biol. 18 (4), 691-701.
Protein ref. UniProtKB:   Q05431
DNA ref. Phytozome 12:   Chr1 (2438005..2439435)
Cluster/Prediction ref. Phytozome Gene 12:   19657090 UniGene:   At.47584
Omic ref. AtProteome:   At1g07890 ATTED-II:   At1g07890 e-FP Browser:   At1g07890 ePlant:   At1g07890 Genevestigator:   At1g07890 TAIR:   At1g07890
Protein sequence: AtAPx01 (At1g07890 / APX1 / CS1 / MATERNAL_EFFECT_EMBRYO_ARREST 6 / MEE6)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27472.73  
PI (pH):   %s   6.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTMRFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHLAGVVAVEVTGGPDIPFHPGREDKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWTSNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPLVEKYADEDAFFADYAEAHMKLSELGFADA

Retrieve as FASTA  
Remarks Complete sequence from 20 cDNAs, 403 ESTs, and genomic (chromo 1, 7 introns and 1 extra intron in 5'UTR).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGAAGAACTC GGATCAAGAC AGGTTTTAAG ATTAAAAAAG GAAGCAAGTT TTAAAAGACT GTTTCTCAAG TAGCTGTTGT TGCCGTTAAA AAGGCAAAGC AGTGAGTAAG AGGAGAGAAA  ATGGTGGCAC CTTTTGCTTT TGGTGGGCCA AATGAAGACA AACTTTTTTA TTTGATCCGT TGAACTTCGA AATTTGAATG AGAATTATTA TTACAAGGTT AAAACTTGAC TTCTGCATCA  TTAAAGAAAA ATTCAAAAGA AACAAAAGAG AAGTATACTA TAGAAAAAGC TATCTCATTG TGGATCAATA GGTCCCTAGG AACCAATAGT AAGTAAAAAG CAAAGTGGTA AACATACAAA  AGCGAGATTA TTCTCAAGTC TCATTTCAAT GTCAAAACTC TCTCTTGTGT GCTAAGTAAA CAGAACCTGT GTGAAAGTAA AACACCTCTG AACTCATTTT CACTATCTCA CAAACCTGCA  TTATCGATCC AATTCTCCCA TCTTATATCT TCTTACATAT TAAGGATCAG AGAAGGTGAT CAAACCTGAT AATTATGTAG ATGTAGCTGA AGCTAAGATA TAAGGCTCAG GAACCACAAA  AACATATCAC TGAATATTTC AAATTAGCTT CAGCATTTTA TGAGTCAAAA TACTAAGAAA CAATGCAAAT TCTCTCATGA AAAGGCTCTC ACATTGCTTT TGCATTCTCC GCAATTATGA  TCCAAACCTT AACCAAAAAC AACTACCCTA TAAGAGTATA AGACCATGTC TGCAGAAATC AGTAGTAACA CAAGAATTTC ATGAGATATT AAAGAAGAAG AAAAGTAGGC CACACAATAG  AATTGAGGAA TCAAGAAAAC AGATACATAC ACTTGGGAAG GACCAGCACA GCAGACGTCT GTTACTACTA ACTAACTCAG ACTTGTCATT GAACTATATT ATATACGGCT CACTTGTTTT  GCTGCAGTAA CTGGCTTATC TTCTTTTCTG GCTTGCGTTA ATAACATGAG TAGAGAGAAA ACACGACTTC CGTCGAGTAG ATTCCTATCA AACAACACCG GTTCTCGAAT CTTTCGACAA  GCCAAGCAAA AGTAGGTGGG CATGAAAATT TGTTCCCCAT GAAACAGAGG ACATTCGTTG TTACCTATTC TAATAACCGA TTCAAAATTC CGAATCGCAG ACTTAATAAA TGTGGACAAT  TAACCAAACC GTGCATTGCT AGGTCTAAAC CGCATTGGTT TATGACCCAC CAATCAAGGA GCGATGGGTG AGAAACCTAA TAACACTGCT GCTGTGACTT TATCATATCC TTAGTCCAAT  TGGGATCTTC GTCTGCGTGA GACGCGTTCA CACCTGCGAC AGATGAAATC ACGGAAATAC CACTGCCCAA CGTGTTCGCA ATAAAAGTCC TCTGATGCCT AATTTCGTCA ATTTACTGAA  GAAAATTCAA CATCAACGCC CTTTTTGATA ATTTCCCCAA AGTTAGTGGG CCCTCCACAC GAAGCATGTA TCCTCCAATT GCATATTGCC AATTATTTCC TAATAATATT GAAGGATTAT  TCTTTTCCCA TCTATATACC ACCAACCCTA AGATCCGAAC GTCCATTTTA AAGCCGTGCG TTTAATCATG ATCGTCAATT ATATTGGCAA ATTTGACCAC ACGATATCCG TCATCTAACG  GCATCTACAG ATCTACCAGA ACGTTCTCAT TCATGACTCT ATATATTTCG CATTTCTTCT CCTCAACGCT CTCATAAAAA GTAGTACTCG TGTCTTACTC GTGCCAGCCA CTCGCATTTC  TCCAGATTTT ATTATCCTTC CTCGAAACAA GGTATGACGG AAACTCTCTC TCTCCCTCTC TGATCCGTCG TTGCTGCTTC CATTTTCATC TTGACTCGAT CGGATCATTG TTATGCTTGG  CTTGATCTGT GCTTAATGAT GTGTTTTTCG TAGTAGATCC ACGATTCGTT GCTGCGATCG GCGTTATTAT CGTCAGCTCT CTCGTTTCTG TTCTGTGGTT CGATATTGCT GAGTTTCTAG  GCTAATCTTA CGAATCTGTG AAAGTTTTTG AGAGATTTGG CTTCTGTAGC TCACTCCTGC TTGATTTAGG TTTTTTTTTT TTCCACTCGT ATGAAGCTGT TTTAGAGGCT GTTGTTGTTT  ATGATTCTCA GCTTGTTATG TATAGTTGGA TTTCGTGAGT TTTGGATTTG ATCTGTGCGT TTATTTAGTA GTGAGGCTCA TGTATATATA TCTGTGTATT TGTTCCAGAG CTTAGCTAAG 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTGTGACGT ATGCTCTGTG TGTGTGTGTG TGTCTCCCCG AGAGTCATGG CTGTTTTTGG TTGGGGGCTG GAGGGGTCGC ATTGCATTTG AACTTTGTCA TATGATTGCT TAATGTACTC  TCGGATTTAC GTATCTGTTT TTTTCGGTGG GTTGCGATTT GAACACATCC GTTGCGCTTT TGCTGCTTAG ACACATTAAT AAAATTAATT TCTCTCGATA TTTATGCCTC AAATCCATTC  ATATCTGCTT AGTCTCTAAT AACAGTAGAA CTTGGATTAA GAGTTTGAAG ATACAGTGGC TAATTGCCTA TATAAAGTGA TAAACAGCCA AATCTTTAAT CAGAAGTAGA AGTATTAGTA  TAACATGATT TGACTATGTA CTACGAGATC AATGGTAAAC CTGACATTGT TCCAAAACCA ATCTAGACCA GTTCACTTAC CGAATTTTAG TTCCATACCC ATAAACCAAT CCAAAGTGAT  TCTATCACCA CATGCAACAG CATGTAATGA TGTGGTGCCC GAATAGGCGG ATTCCATCGA TGTTGATCAG ACGATGCTTT AGATCAAAGA CCGGCGTGAG CTGAGACGGA TGGCTCTGGC  TTATAATGTC ACCACTATGA TTACCAAAGT GTTTGCTGCT TTGATCACGG CCGAGGGAGT AAAGAGCTTG AAGTCAAGTG TTATTCAAAT GATTGTCATT CAGCACTCCT TTTCTAGGTG  AAGGATCTTG CCTATGCGCT TCTCTAAAAC CGTTTTTTTT TCTATTTTTA TGTTGTCGAT GGAAACGTCT CTTATTTTTA TCTTGAATTG AACCGAATCT GCAATTAGGA CCCTCTTGAA  TCTTGAGTGG TCTATGTCGT AATCAGGTTT TAGAAAAGAT GAGATTGGAG CGACGAGTAG AGAGAAGGGA AGAGTGGAGT GACTTTTTGT GAACACGTTC ACACCATTTA GAGTTCGAAA 
CGGTTCTTTT TTCTTTTTGT GTGTGTGTGT GGGAAATTG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGAACTACCCAACCGTGAGCGAAGATTACAAGAAGGCTGTTGAGAAGTGCAGGAGGAAGCTCAGAGGTTTGATCGCTGAGAAGAACTGTGCACCCATCATGGTCCGACTCGCG
TAAGTAACTAACCATATTTGCTTGTGGTTTTGAAGTATGTAGGATTATGAACTTTCTCATGGCTGATCTGTCTGGCTAAACTGCAGATGGCACTCTGCTGGAACTTTCGATTGTCAATCA
AGGACTGGAGGTCCATTCGGAACAATGAGGTTTGACGCTGAGCAAGCTCATGGAGCCAACAGTGGTATCCACATTGCTCTTAGGTTGTTGGACCCCATCAGGGAGCAATTCCCTACCATC
TCTTTTGCTGATTTCCATCAG
GTACATGGTTTTAAATTTTAAAAAGCACTATTTGGTTAACGGTGATAACTGTAAGGTTTGGATTCTAACTCTAGATATCCTTGTGGTGTGAAATTGATC
ATTCAGCTTGCTGGTGTTGTGGCCGTTGAAGTTACTGGTGGCCCTGACATTCCTTTCCACCCTGGAAGAGAGGTTAGTCATTGCTGTAGATTTGTTTGCCGTCTCTAAGGTTATCATATA
CTCAATTTGGTCGAGAGAACGTGTTCTGCTTTCTTTGTAGAGATGGCTGATTGATAATTGTGGGACTTGATTTTCTGTTTCTAAAATGCATATCTTGATTTCAGGACAAGCCCCAACCAC
CTCCAGAGGGTCGTCTTCCTGATGCTACCAAGGGTTGTGACCATTTGAGAGATGTCTTTGCTAAGCAGATGGGCTTATCTGACAAAGACATTGTCGCTTTATCTGGTGCCCACACTCTG
G
TTCGTTTCTCTCCAACTGCTTAAAACTTTAAAATTTGTTTGCTCCAAGCTTACAAATTCTGATGAGTGCTAGCAAAATATGATATCGCAGGGACGATGCCACAAGGATAGGTCTGGCTTC
GAAGGTGCATGGACATCAAACCCTCTAATCTTCGACAACTCTTACTTCAA
GTGAGTATCCCAAGTTCCCTTGTAGGAGGATTCAGTGGCTTATATGGTTACTAATCAAATTATATATGGG
CAGGGAACTCTTGAGCGGAGAGAAGGAAGGCCTTCTTCAGCTTGTCTCTGACAAAGCACTATTGGACGACCCTGTTTTCCGTCCTTTGGTCGAGAAATACGCTGCTGTATGTCTTTCATT
CCCTTTTTTCTGTTTTTCACTTGGTAGAGAGAGAGAGAAGAGAACTCATGGTTTCTTGTGACAATGTGAACAGGATGAAGATGCCTTTTTCGCTGATTACGCTGAGGCCCACATGAAGCT
TTCTGAGCTTGG
GTACTTATCCTGAATCTATGAATCATTTAGAAAGTAAATATTAATTCAGTGGTGTGATTTGAGTTTGTATCTGTTGGTTGCAGGTTTGCTGATGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGAACTACCCAACCGTGAGCGAAGATTACAAGAAGGCTGTTGAGAAGTGCAGGAGGAAGCTCAGAGGTTTGATCGCTGAGAAGAACTGTGCACCCATCATGGTCCGACTCGCA
TGGCACTCTGCTGGAACTTTCGATTGTCAATCAAGGACTGGAGGTCCATTCGGAACAATGAGGTTTGACGCTGAGCAAGCTCATGGAGCCAACAGTGGTATCCACATTGCTCTTAGGTTG
TTGGACCCCATCAGGGAGCAATTCCCTACCATCTCTTTTGCTGATTTCCATCAG
CTTGCTGGTGTTGTGGCCGTTGAAGTTACTGGTGGCCCTGACATTCCTTTCCACCCTGGAAGAGAG
GACAAGCCCCAACCACCTCCAGAGGGTCGTCTTCCTGATGCTACCAAGGGTTGTGACCATTTGAGAGATGTCTTTGCTAAGCAGATGGGCTTATCTGACAAAGACATTGTCGCTTTATCT
GGTGCCCACACTCTG
GGACGATGCCACAAGGATAGGTCTGGCTTCGAAGGTGCATGGACATCAAACCCTCTAATCTTCGACAACTCTTACTTCAAGGAACTCTTGAGCGGAGAGAAGGAA
GGCCTTCTTCAGCTTGTCTCTGACAAAGCACTATTGGACGACCCTGTTTTCCGTCCTTTGGTCGAGAAATACGCTGCT
GATGAAGATGCCTTTTTCGCTGATTACGCTGAGGCCCACATG
AAGCTTTCTGAGCTTGG
GTTTGCTGATGCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTCGTTTCTG TTCTGTGGTT CGATATTAGC TTAGCTAAGA TGACGAAGAA CTACCCAACC GTGAGCGAAG ATTACAAGAA GGCTGTTGAG AAGTGCAGGA GGAAGCTCAG AGGTTTGATC  GCTGAGAAGA ACTGTGCACC CATCATGGTC CGACTCGCAT GGCACTCTGC TGGAACTTTC GATTGTCAAT CAAGGACTGG AGGTCCATTC GGAACAATGA GGTTTGACGC TGAGCAAGCT  CATGGAGCCA ACAGTGGTAT CCACATTGCT CTTAGGTTGT TGGACCCCAT CAGGGAGCAA TTCCCTACCA TCTCTTTTGC TGATTTCCAT CAGCTTGCTG GTGTTGTGGC CGTTGAAGTT  ACTGGTGGCC CTGACATTCC TTTCCACCCT GGAAGAGAGG ACAAGCCCCA ACCACCTCCA GAGGGTCGTC TTCCTGATGC TACCAAGGGT TGTGACCATT TGAGAGATGT CTTTGCTAAG  CAGATGGGCT TATCTGACAA AGACATTGTC GCTTTATCTG GTGCCCACAC TCTGGGACGA TGCCACAAGG ATAGGTCTGG CTTCGAAGGT GCATGGACAT CAAACCCTCT AATCTTCGAC  AACTCTTACT TCAAGGAACT CTTGAGCGGA GAGAAGGAAG GCCTTCTTCA GCTTGTCTCT GACAAAGCAC TATTGGACGA CCCTGTTTTC CGTCCTTTGG TCGAGAAATA CGCTGCTGAT  GAAGATGCCT TTTTCGCTGA TTACGCTGAG GCCCACATGA AGCTTTCTGA GCTTGGGTTT GCTGATGCTT AAGCTGTGAC GTATGCTCTG TGTGTGTGTG TGTGTCTCCC CGAGAGTCAT  GGCTGTTTTT GGTTGGGGGC TGGAGGGGTC GCATTGCATT TGAACTTTGT CATATGATTG CTTAATGTAC TCTCGGATTT ACGTATCTGT TTTTTTCGGT GGGTTGCGAT TTGAACACAT 
CCGTTGCGCT TTTGCTGCTT AGACACATTA ATAAAATTAA TTTCTCTCGA TATTTATGCC TC 

Retrieve as FASTA