Entry information : AtAPx03 (At4g35000 / APX3)
Entry ID 1891
Creation 2006-06-14 (Christophe Dunand)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-15 (Christophe Dunand)
Peroxidase information: AtAPx03 (At4g35000 / APX3)
Name (synonym) AtAPx03 (At4g35000 / APX3)
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation Peroxisomal
Tissue types Flower buds
Flowers
Leaves
Roots
Seedlings
Seeds
Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtAPx03
start..stop
S start..stop
AlyAPx03 579 0 1..287 1..287
AhalAPx01 579 0 1..287 1..287
BnAPx03-1Aa_other 548 0 1..287 1..287
BstrAPx03 545 0 1..287 1..287
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16667429..16667541 113 N° 2 16667153..16667277 125 N° 3 16666939..16666988 50 N° 4 16666327..16666392 66
N° 5 16666190..16666238 49 N° 6 16665994..16666076 83 N° 7 16665831..16665910 80 N° 8 16665584..16665686 103
N° 9 16665007..16665201 195  
complement(join(16665007..16665201,16665584..16665686,16665831..16665910,1666599 4..16666076,16666190..16666238,16666327..16666392,16666939..16666988,16667153..1 6667277,16667429..16667541))


exon

Literature and cross-references AtAPx03 (At4g35000 / APX3)
Protein ref. UniProtKB:   Q42564
DNA ref. Phytozome 11:   Chr4 (16667541..16665007)
mRNA ref. GenBank:   NM_119666.3
Cluster/Prediction ref. Phytozome Gene 11:   19648154
Omic ref. AtProteome:   At4g35000 ATTED-II:   At4g35000 e-FP Browser:   At4g35000 ePlant:   At4g35000 TAIR:   At4g35000
Protein sequence: AtAPx03 (At4g35000 / APX3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   287
PWM (Da):   %s   31424.09 Transmb domain:   %s   o258-280i
PI (pH):   %s   6.72
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPIVDAEYLKEITKARRELRSLIANKNCAPIMLRLAWHDAGTYDAQSKTGGPNGSIRNEEEHTHGANSGLKIALDLEGVKAKHPKITYADLYLAGVVAVEVTGGPDIVFVPGRKDSNVCPKEGRLPDAKQGFQHLRDVFYRMGLSDKDIVALSGGHTGRAHPERSGFDGPWTQEPLKFDNSYFVELLKGESEGLLKLPTDKTLLEDPEFRRLVELYADEDAFFRDYAESHKKLSELGFNPNSSAGKAVADSTILAQSAFGVAVAAAVVAFGYFYEIRKRMK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns), 10 cDNAs and 76 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTCAAGGTT CACAAGAATC ACTTACCTAC CAAGAAAGGA GTTAAGACTT TTGTGAGGAT TGCTAGTCTT GGACACGCGT TGCACGCTTG GCTTAACGGA GAATACCTTG GTAAGAATTT  GTGCAAGAAT GATCTACAAG TACTACAACA ATGAGCTATA ATAATGATAT CTTCTTAACA GGAAGTGGAC ATGGAAGCCA CGAAGAGAAG AGTTTTGTTT TCCAAAAACA GGTTACACTA  AAAGCAGGAG AGAATCATCT TGTAATGCTT GGTGTTCTCA CAGGATTCCC AGTAAGTAAT TAACAAACAT AATTCAATAT CTATAGATGA AGATTTGTTT CGTTAATGTT TGGGATTTTT  GGTTCTTACA GGACAGTGGA TCTTACATGG AGCATAGATA CACCGGTCCT CGTGGTATTT CCATCTTAGG ATTGACTTCT GGAACACTTG ATCTCACTGA GAGCAGCAAA TGGGGAAACA  AGGTTTATAA ACAATTTCTC CGTTATTGTA TTTCAACATT GAGTATGCAT TTCCTTCTTC TGATCCGTTT TTTTCGATCA TTAGATCGGT ATGGAAGGTG AAAAACTTGG AATCCACACT  GAGGAAGGTT TAAAGAAGGT CGAATGGAAA AAATTCACCG GAAAAGCACC AGGACTTACA TGGTACCAGG TAAGAGACAA AAACAAAAAT CAAACTATAC AGAGTATGAT TGGTATGATA  TGTAGAAGTT TTCTAAGGAA TGTGAAACAT TGCAGACATA CTTTGATGCA CCAGAGAGCG TAAGCGCAGC AACGATTCGC ATGCATGGAA TGGGAAAAGG GTTGATTTGG GTGAACGGAG  AAGGCGTTGG AAGATATTGG CAATCGTTCT TGTCTCCATT AGGTCAACCT ACACAAATAG AGTATCACAT CCCTAGATCT TTCTTAAAGC CCAAGAAGAA CCTTCTTGTT ATCTTTGAGG  AAGAGCCTAA TGTGAAGCCT GAGCTTATGG ACTTTGCCAT CGTTAACAGA GACACTGTTT GTTCTTACGT TGGAGAAAAC TACACTCCAA GTGTTAGACA CTGGACTAGG AAGAAAGATC  AAGTTCAAGC CATCACAGAT AACGTGAGTC TCACGGCTAC TCTTAAATGC TCAGGCACTA AGAAGATCGC AGCAGTTGAG TTCGCTAGCT TCGGAAACCC TATTGGTGTT TGTGGAAACT  TCACACTTGG TACTTGTAAT GCTCCTGTTT CAAAGCAAGT CATCGAGAAG GTAAAATATT ATATCTTGTT TCTTCTTGCT ATATAGTTTG TACCTTATGA TAGGAGTAAC CAATAAAAAA  AATCTATTGC AGCACTGTTT GGGGAAAGCT GAATGTGTGA TTCCGGTGAA CAAGAGCACG TTTCAACAAG ACAAGAAGGA TTCATGTAAG AACGTTGTGA AGATGCTTGC CGTGCAAGTC  AAGTGTGGTC GTGGGAAGAA GAACTGAAGA GTGTATATCA TCACATTACA TATGGTTCAT GTATTGTGTT TAGTAGACCA ATTTCAAAGT GTTGTGACAT CGATTTTTGT CGTTCTGTTT  GTATTTGATT TCTTCAATTT AACTCTAATA CACGAGTAAT ATATTCGAAT ATGATCCAGA AAACATAAAT CACCGGAAAA AATAATGGTT TATGTCCATT TTTATTCAAT GTTTCCATTT  TACAAAATTT AAGGAATGAA CATGCACGCT GTTTAACAAA TAACTAGCAA ACTCGTGTGC CGTTTTTTGT GTAACAAAAT GACATGCAAG TCACGTGCCA ACAATCGTAT CTAAAAAGCC  AATGAGGTCC ACCGAAAGAT GTGGCTGAGG AAAACAGGAG ATAACTGACA CCGCCCATTC AAATCCCGTT TCTCATTGGG TGGTTTTATC TCTTTGGCCC AAATTTCGGT GTAACCAAAA 
AAAATCTTCA CACACATCCT TGACCATTTT CTTGTTCATC GCTCTCTTTC TTCTTCACAA ATCCTAAACG AGTAGGAGCT 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACGAAATAGG AAGTAAAACA CGAAGCAACG ATGCTCTTAT TTGGGTATTA AAGAAACTAT TAATCGTCTA TCGAATCTAT TTTGCTGCTA CAAGATTCTA AACTCTTTGA ATCCACGATT  CTACTGTTTA GTAGTAAAAA AGTTAAAAAG TCAATATTTT GGGTCCGTGA TTCATTTTTG CGATATTTGT TCATTGCAAT GTTCGTTTCA CTTATTAATT AGTACCAAAG AAAAAGAAAA  AAGAAAGAAA CAAAGATCGG TCGATATCTA CCAAAGTGGG GACATAACCT GAAACTTGAC CTAACCTGGT AGTGGTAGGT TTAGTTAGGT AGGAAACTTC TACTAAGAAA TTAAAATTAA  ATTTTTTTTT GCTTTCGTAT TTTCATTAAA GAAGATAATA TATGATGTTG GTTGCCAGTT ACCTAAATAT AGGCTCGGGA TGACATGTAA TGGACGCAAA GTAGCAAATA GCTTTATTCA  AGTTGACATA AAAGAATTGT TGTTACGTAA AAGAAGTGTA CTGTATTTTA ACAGAATGTG AAATCACCTA ACAATAACTT ATATAAGAAA CTAAAAGAAA GAAACGCATG TCTTCTAAAT  TTGGCAAGAA CGAAGGTTTT GTAACTTGTA AGTAGTTTAA ATAAATAAAC CATACATTTT TAATAATTAG GAAATATATG TTACATGTTG CACTTTGTAT ACATTCTAAA AGTCGTATAA  TGTACCTATT TTTTTAAGAT TTGTTTGGTG TGTGTGTAGA TAACAAATCA CATGTCAATT CTATCCCATT TCTATTTTCT TCGTTATTAA ATATACAAAT ATGTCGGTAG GAGTTCAGAG  TAAATGTACA CCATGAAATC TACCAAACTC TTTTAAGATT GTCTTTCAGG TATCAAACAA ACTTTCACCA ATAAAGCTTT TTCCCTTTTC CAAATAAAGA ACTCCAAACA AGAATAAAAA 
CCACAATCAT TATTCGATAT GTTTTTATCG ATACTTATTT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCACCGATTGTTGATGCGGAGTACTTGAAAGAGATCACTAAGGCTCGCCGTGAGCTCCGTTCTCTCATCGCGAACAAGAACTGTGCTCCTATCATGCTCCGATTGGCGTAAGTT
TTCGATTTCCTTGGTTTTTCGTCGAGTTGACTGTTACAGATTTCGTTTATTCATGTGGAGATCGTTCGATTGTAGTTAGGCTGTAGAATCGATTTTGTTTGTTTTTGAATGTTGAAATGT
TTGTATCATCTGGTTTTTATGAAGATGGCACGATGCTGGAACCTATGATGCTCAATCGAAGACCGGTGGACCTAATGGCTCTATCAGGAACGAAGAAGAGCACACTCATGGTGCCAACAG
TGGTTTGAAGATCGCTCTCGATCTCTGTG
GTAGGATTTTGATTTAGTTTTTGTAGATTCACTTTCTGGATAATTTCATGCGATGTATCCGTTTTATGTTGTGGTTTAAGAACACTGTTCA
AAATAATTACATTATGCTTTTGGAAATGGACTTTGTATCGCTTAATTATGAGATCCTATCTTTGATGTTTCAGAGGGCGTGAAAGCTAAGCATCCCAAAATCACATACGCAGACCTGTAT
CAG
GTGAGTTAAGGCTGTGAGAGAAATCTTTTTGATGTCCTTGTTGCTTTTTCTGCACATTTGTTTTTCAAAGTTCGCTGGAACTGTATTCGGCTTGTGTCATTACCTCGTCCCAGGTTT
GAGCTTGTTGTTTAGGAGACTTAGTTGATAGTTGAGCAGCTGTGTAAATATGGTTTCAGTTGTAATTTGTTTCAGGAGATGTTACTGATTGTGATTTGGTTTACAAAAATCATAGATTGA
CTATGTTGTTCAACTAGAACTTTTATCTCTTGCAGTAATAGCTAAATTCAAGTAAAATATACACTGAATGAATTCAAACGACCAAGAAGGAAACTGTAATGTAATGTCAATCTGTTTCCA
TCCTAAGTCACATGTCTGTCGTCTGTACCTATAACCTGTCTCTACGACTGTTTGTATTGCCGTTTCTCCATTTTATATTTGGTCTTACAAGGTCGAGGCTTTATTTATGAATTCCCAATA
GAAGTGTACCAGTTTAATGGCAATTAAGTTTTGGGTATGAATTATTTACTTTTAAGTGTTTTGTTTCAGCTTGCTGGTGTGGTAGCAGTTGAGGTTACTGGTGGACCTGACATCGTGTTC
GTTCCCGGGAGAAAG
GTATACTTTCTCATCTCTTGAGACATTATAACAGCTTATCAGTTTAACACTAAAGCAAACATAATTACTGTATGTTTCTTCTTGATAGGATTCAAATGTCTGCCC
CAAGGAAGGAAGACTTCCTGATGCCAAACAAG
GTACACTAAATTCTTGTATCAATTATAACAAACTTTTCATGTTTTCTACTGATAATCTTGTTTTGGAATTGGAAGATTTTTTCTATGA
ATTCACATTGTTTATATCTCTGTAGGTTTCCAACATCTCAGAGATGTCTTCTACCGCATGGGACTATCTGATAAGGATATTGTGGCACTCTCAGGGGGTCATACTCTGGTAAATTCATTG
GTCACTTACTTAACTTCCGTTGTTTTTGAACAAATATGCTTGTTGTGCTTATGACCACATTGGGTGTTTAGGGAAGGGCTCACCCGGAGAGGTCAGGCTTTGATGGACCATGGACCCAAG
AGCCGCTGAAGTTTGACAACTCCTACTTCGT
GTAATTTTCATTTCTTTATCCTCAGAGATTTTCTTTGTGCATTTTTTTAATCTTTTCTGTTTGTGTCTCCAAGAAATAAAAGCAGCAAA
CAGATACTTTTTTACATGATCGGTTATCCATGATTATTTACTGTTTTGGTACCAGGGAACTGCTGAAAGGAGAATCAGAGGGCTTGTTGAAACTTCCAACTGACAAGACCTTATTGGAAG
ACCCGGAGTTCCGTCGTCTTGTTGAGCTTTATGCAAAG
GTATAATATACTGGAGATCTTCTCTGCCTCTTTGCCATTTGTTTCTTGCGTTGCTATAATAACCATTGGAACATAACTCGAT
TTCCTTTATTGGTTTCACATTTTCACTGAATCCACAAGCACACACACTGAATCACAAACCAAATTATCTAGGGTTTTGTTCTAGAGAACCCCACGGATCCTTATCGCCTTTATAGTTGCT
GATGTTGCAAAATGATAAAATGAACACTCTTACTACTATCAGTGAGAACTGTAATATTAGCTTTTTGTTAGAACCGTAAACAGAAATTCCTATGGTTCTTTATGATTTCCTTGCTTAATT
AAGTTTCAATAAGATAAGAAAGTGTTGTTATGTGTTGACAAGTTCAGTTTGTGGTGGCAGGATGAAGATGCATTCTTCAGAGACTACGCGGAATCGCACAAGAAACTCTCTGAGCTTGGT
TTCAACCCAAACTCCTCAGCAGGCAAAGCAGTTGCAGACAGCACGATTCTGGCACAGAGTGCGTTCGGGGTTGCAGTTGCTGCTGCGGTTGTGGCATTTGGTTACTTTTACGAGATCCGG
AAGAGGATGAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCACCGATTGTTGATGCGGAGTACTTGAAAGAGATCACTAAGGCTCGCCGTGAGCTCCGTTCTCTCATCGCGAACAAGAACTGTGCTCCTATCATGCTCCGATTGGCATGGCAC
GATGCTGGAACCTATGATGCTCAATCGAAGACCGGTGGACCTAATGGCTCTATCAGGAACGAAGAAGAGCACACTCATGGTGCCAACAGTGGTTTGAAGATCGCTCTCGATCTCTGTG
AG
GGCGTGAAAGCTAAGCATCCCAAAATCACATACGCAGACCTGTATCAG
CTTGCTGGTGTGGTAGCAGTTGAGGTTACTGGTGGACCTGACATCGTGTTCGTTCCCGGGAGAAAGGATTCA
AATGTCTGCCCCAAGGAAGGAAGACTTCCTGATGCCAAACAAG
GTTTCCAACATCTCAGAGATGTCTTCTACCGCATGGGACTATCTGATAAGGATATTGTGGCACTCTCAGGGGGTCAT
ACTCTG
GGAAGGGCTCACCCGGAGAGGTCAGGCTTTGATGGACCATGGACCCAAGAGCCGCTGAAGTTTGACAACTCCTACTTCGTGGAACTGCTGAAAGGAGAATCAGAGGGCTTGTTG
AAACTTCCAACTGACAAGACCTTATTGGAAGACCCGGAGTTCCGTCGTCTTGTTGAGCTTTATGCAAAG
GATGAAGATGCATTCTTCAGAGACTACGCGGAATCGCACAAGAAACTCTCT
GAGCTTGGTTTCAACCCAAACTCCTCAGCAGGCAAAGCAGTTGCAGACAGCACGATTCTGGCACAGAGTGCGTTCGGGGTTGCAGTTGCTGCTGCGGTTGTGGCATTTGGTTACTTTTAC
GAGATCCGGAAGAGGATGAAGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTGAGGAAA ACAGGAGATA ACTGACACCG CCCATTCAAA TCCCGTTTCT CATTGGGTGG TTTTATCTCT TTGGCCCAAA TTTCGGTGTA ACCAAAAAAA ATCTTCACAC ACATCCTTGA  CCATTTTCTT GTTCATCGCT CTCTTTCTTC TTCACAAATC CTAAACGAGT AGGAGCTATG GCTGCACCGA TTGTTGATGC GGAGTACTTG AAAGAGATCA CTAAGGCTCG CCGTGAGCTC  CGTTCTCTCA TCGCGAACAA GAACTGTGCT CCTATCATGC TCCGATTGGC ATGGCACGAT GCTGGAACCT ATGATGCTCA ATCGAAGACC GGTGGACCTA ATGGCTCTAT CAGGAACGAA  GAAGAGCACA CTCATGGTGC CAACAGTGGT TTGAAGATCG CTCTCGATCT CTGTGAGGGC GTGAAAGCTA AGCATCCCAA AATCACATAC GCAGACCTGT ATCAGCTTGC TGGTGTGGTA  GCAGTTGAGG TTACTGGTGG ACCTGACATC GTGTTCGTTC CCGGGAGAAA GGATTCAAAT GTCTGCCCCA AGGAAGGAAG ACTTCCTGAT GCCAAACAAG GTTTCCAACA TCTCAGAGAT  GTCTTCTACC GCATGGGACT ATCTGATAAG GATATTGTGG CACTCTCAGG GGGTCATACT CTGGGAAGGG CTCACCCGGA GAGGTCAGGC TTTGATGGAC CATGGACCCA AGAGCCGCTG  AAGTTTGACA ACTCCTACTT CGTGGAACTG CTGAAAGGAG AATCAGAGGG CTTGTTGAAA CTTCCAACTG ACAAGACCTT ATTGGAAGAC CCGGAGTTCC GTCGTCTTGT TGAGCTTTAT  GCAAAGGATG AAGATGCATT CTTCAGAGAC TACGCGGAAT CGCACAAGAA ACTCTCTGAG CTTGGTTTCA ACCCAAACTC CTCAGCAGGC AAAGCAGTTG CAGACAGCAC GATTCTGGCA  CAGAGTGCGT TCGGGGTTGC AGTTGCTGCT GCGGTTGTGG CATTTGGTTA CTTTTACGAG ATCCGGAAGA GGATGAAGTA AACGAAATAG GAAGTAAAAC ACGAAGCAAC GATGCTCTTA  TTTGGGTATT AAAGAAACTA TTAATCGTCT ATCGAATCTA TTTTGCTGCT ACAAGATTCT AAACTCTTTG AATCCACGAT TCTACTGTTT AGTAGTAAAA AAGTTAAAAA GTCAATATTT 
TGGGTCCGTG ATTCATTTTT GCGATA 

Retrieve as FASTA