Entry information : NcCcP (NcrassaCcP)
Entry ID 1989
Creation 2006-08-30 (Nenad Bakalovic)
Last sequence changes 2012-02-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-25 (Catherine Mathe (Scipio))
Peroxidase information: NcCcP (NcrassaCcP)
Name (synonym) NcCcP (NcrassaCcP)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Neurospora
Organism Neurospora crassa    [TaxId: 5141 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NcCcP
start..stop
S start..stop
NtetCcP01 739 0 1..358 1..358
NdisCcP01 679 0 1..358 1..358
SmaCcP 676 0 1..358 15..372
CgCcP 609 0 6..358 3..355
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5223335..5223824 490 N° 2 5222692..5223278 587  
complement(join(5222692..5223278,5223335..5223824))


exon

Literature and cross-references NcCcP (NcrassaCcP)
Literature Zamocky, M. Eur. J. Biochem. 271, pp 3297-3309 (2004)
Protein ref. GenPept:   28925995 UniProtKB:   Q7SDV9
DNA ref. JGI genome:   supercont10.1 (5223824..5222692)
Protein sequence: NcCcP (NcrassaCcP)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358
PWM (Da):   %s   39721.84  
PI (pH):   %s   8.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASRTATRTLRALRTSTRPALTAAPRAAFRQGGRRLYSSEPAKSGGSNIWAWAIGAGALGAGGLWYLNQDGASATPKVFAPKFDDYQAVYNEIASRLEEKDDYDDGSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKAARDFLEPVKAKFPWITYSDLWILGGVCAIQEMLGPQIPYRPGRQDRDAAGCTPDGRLPDASQAQDHLRNIFYRMGFNDQEIVALSGAHALGRCHADRSGFDGPWTFSPTVLTNDYYKLLLDEKWQWKKWNGPKQYEDKKTKSLMMLPADMALIQDKKFKQWVEKYAADNELFFKDFSNVIVKLFELGVPFAENSERWVFKTVNA

Retrieve as FASTA  
Remarks Complete sequence from genomic (no intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCTCCCGCACTGCCACCCGCACTCTCCGCGCTCTGCGCACCTCGACTCGTCCTGCGCTCACTGCCGCGCCCCGCGCTGCTTTCCGCCAGGGTGGTCGTCGTCTTTACTCTTCT
GAGCCCGCCAAGTCCGGTGGCTCCAACATTTGGGCTTGGGCTATCGGTGCCGGTGCTCTCGGTGCCGGCGGTCTGTGGTATCTCAACCAGGACGGCGCTTCCGCTACCCCCAAGGTTTTC
GCTCCCAAGTTCGACGACTACCAGGCCGTGTACAACGAGATTGCCTCTCGCCTCGAGGAGAAGGATGACTACGACGACGGCAGCTACGGCCCAGTCCTCGTCCGTCTCGCATGGCACGCC
AGCGGCACCTATGACAAGGAGACCGGCACTGGTGGCTCCAACGGTGCCACCATGCGCTTCGCTCCTGAGTCTGACCATGGTGCCAACGCCGGCCTGAAGGCTGCTCGTGACTTCCTCGAG
CCTGTCAAGG
GTAAGCTGCTACCATCCTTAAATCGTGGTATTTCAACATACTGACGTCCCAAACAGCCAAGTTCCCTTGGATCACCTACTCCGATCTCTGGATCCTCGGCGGTGTTTGCG
CCATCCAGGAGATGCTTGGCCCCCAGATCCCCTACCGCCCCGGTCGCCAGGACCGTGATGCTGCTGGTTGCACTCCCGATGGCCGTCTTCCTGATGCCTCCCAGGCCCAGGACCATCTCC
GCAACATCTTCTACCGCATGGGCTTCAACGATCAGGAGATCGTTGCTCTTTCCGGTGCTCACGCTCTCGGCCGCTGCCACGCTGACCGCTCCGGCTTTGACGGTCCCTGGACTTTCTCCC
CTACCGTTTTGACCAACGATTACTACAAGCTGCTCCTCGACGAGAAGTGGCAGTGGAAGAAGTGGAACGGCCCTAAGCAGTATGAGGACAAGAAGACCAAGTCCCTCATGATGCTCCCCG
CCGATATGGCCCTCATCCAGGACAAGAAGTTCAAGCAGTGGGTGGAGAAGTACGCCGCCGACAACGAGCTCTTCTTCAAGGACTTCTCCAATGTCATTGTCAAGCTCTTTGAGCTCGGTG
TTCCTTTCGCCGAGAACTCCGAGCGCTGGGTCTTCAAGACCGTCAATGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCTCCCGCACTGCCACCCGCACTCTCCGCGCTCTGCGCACCTCGACTCGTCCTGCGCTCACTGCCGCGCCCCGCGCTGCTTTCCGCCAGGGTGGTCGTCGTCTTTACTCTTCT
GAGCCCGCCAAGTCCGGTGGCTCCAACATTTGGGCTTGGGCTATCGGTGCCGGTGCTCTCGGTGCCGGCGGTCTGTGGTATCTCAACCAGGACGGCGCTTCCGCTACCCCCAAGGTTTTC
GCTCCCAAGTTCGACGACTACCAGGCCGTGTACAACGAGATTGCCTCTCGCCTCGAGGAGAAGGATGACTACGACGACGGCAGCTACGGCCCAGTCCTCGTCCGTCTCGCATGGCACGCC
AGCGGCACCTATGACAAGGAGACCGGCACTGGTGGCTCCAACGGTGCCACCATGCGCTTCGCTCCTGAGTCTGACCATGGTGCCAACGCCGGCCTGAAGGCTGCTCGTGACTTCCTCGAG
CCTGTCAAGG
CCAAGTTCCCTTGGATCACCTACTCCGATCTCTGGATCCTCGGCGGTGTTTGCGCCATCCAGGAGATGCTTGGCCCCCAGATCCCCTACCGCCCCGGTCGCCAGGACCGT
GATGCTGCTGGTTGCACTCCCGATGGCCGTCTTCCTGATGCCTCCCAGGCCCAGGACCATCTCCGCAACATCTTCTACCGCATGGGCTTCAACGATCAGGAGATCGTTGCTCTTTCCGGT
GCTCACGCTCTCGGCCGCTGCCACGCTGACCGCTCCGGCTTTGACGGTCCCTGGACTTTCTCCCCTACCGTTTTGACCAACGATTACTACAAGCTGCTCCTCGACGAGAAGTGGCAGTGG
AAGAAGTGGAACGGCCCTAAGCAGTATGAGGACAAGAAGACCAAGTCCCTCATGATGCTCCCCGCCGATATGGCCCTCATCCAGGACAAGAAGTTCAAGCAGTGGGTGGAGAAGTACGCC
GCCGACAACGAGCTCTTCTTCAAGGACTTCTCCAATGTCATTGTCAAGCTCTTTGAGCTCGGTGTTCCTTTCGCCGAGAACTCCGAGCGCTGGGTCTTCAAGACCGTCAATGCTTAG

Retrieve as FASTA