Entry information : PpePrx11 (ppa008489m)
Entry ID 2047
Creation 2006-07-20 (Christophe Dunand)
Last sequence changes 2011-06-29 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx11 (ppa008489m)
Name (synonym) PpePrx11 (ppa008489m)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type Fruits
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx11
start..stop
S start..stop
RcPrx21 525 0 23..329 28..334
CsaPrx32 525 0 1..329 1..329
MePrx11 524 0 1..329 1..329
VvPrx04 523 0 9..329 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20982820..20983035 216 N° 2 20982503..20982703 201 N° 3 20982221..20982386 166 N° 4 20981373..20981779 407
complement(join(20981373..20981779,20982221..20982386,20982503..20982703,2098282 0..20983035))


exon

Literature and cross-references PpePrx11 (ppa008489m)
Literature Callahan,A.M., Richie,A.J., Byrne,G.B., Artlip,T.S. and Bassett,C.L. Expressed Sequence Tags of Fruit from 'Loring' Peach. Unpublished (2000).
DNA ref. Phytozome 12:   scaffold_6 (20983035..20981373)
Protein sequence: PpePrx11 (ppa008489m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (304)
PWM (Da):   %s   35562.83 (32717.4)  
PI (pH):   %s   8.04 (7.99) Peptide Signal:   %s   cut: 26 range:26-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRLNPILVWSLCLSLCLFLCPTSAQLKTNFYANVCPNVENIVKNVVTQKFQQTFVTVPATIRLFFHDCFVQGCDASVLVASTGNNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPQCKNKVSCADILALATRDVIVLSGGPSYAVELGRLDGLSSSSKNVDGNLPKPTFNLNQLNSMFAAHGLSQADMVALSAAHTVGFSHCDRFSNRIYSFSAGNPVDPSLNKTYATQLQQMCPKNVDPDIAINMDPNTPRTFDNVYFKNLELGQGLFTSDQVLFTDARSQPTVKTWAKDNAAFQQAFITAMTKLGRVGVKTGNKGNIRSDCSVLN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAGGCTCAATCCTATACTCGTTTGGTCGCTTTGCCTTAGTTTGTGCCTCTTTCTCTGTCCCACATCGGCGCAGCTAAAAACAAACTTCTATGCCAACGTCTGCCCCAACGTCGAA
AACATTGTAAAAAATGTTGTCACTCAAAAATTTCAACAAACATTTGTCACAGTCCCAGCAACCATCCGTCTCTTTTTTCATGATTGCTTTGTCCAG
GTAACTCAACTGCTAAATTTACCA
TAAGAAACTCAAAGATTGACAAGTTTTTTTAACTCGGGTTTCGATCAAAATCTGATCTTTGTTTTTTTGCTGTGAAAAATAAAATGGTTTAGGGTTGTGATGCTTCGGTTTTAGTTGCTT
CCACTGGAAACAACAAAGCAGAGAAGGATCATCCAGATAATCTGTCATTAGCTGGAGATGGTTTTGATACAGTGATCAAAGCCAAAGCAGCAGTTGATGCAGTTCCTCAGTGCAAAAACA
AAGTCTCTTGTGCTGATATTCTTGCCTTGGCCACCAGAGATGTCATTGTTCTG
GTTTGTTCATGATCACATTAACTTCTGCTGCTTATTATTATTGTACCAATTAAGGGTGGGATTTGAT
GGTTCAGTTGATGTTAATGATAATTAAACGTGTTAATTATTTAATGCAGTCTGGTGGACCTTCGTATGCAGTTGAGTTGGGGAGATTGGACGGACTAAGTTCAAGTTCTAAAAATGTAGA
TGGGAACCTCCCCAAGCCAACCTTCAATTTGAACCAGCTCAATTCCATGTTTGCTGCCCATGGGTTGTCCCAGGCTGACATGGTCGCTCTTTCAG
GTAAGACCGTGTCTCTATTGACCAA
TCATAATGTGATGGGTGTTGTGTGTGCGGGGAGAAATGCTTTGGTCCAACGGTTAGACCAAGTCATCCATCCGGCCACAAACATAAACAATAGAGCTCTCCGGCATTGGATGAGCTAGTC
TGAGGCCATAGGGACTAAATACAGAAGATTTACATTGTTTATGTGTGGTCAGATAAGTGACGTGACTAATAACCGAATCAATGAATTTATCAAGTGTGCGGATTTTGACACTAAGCGTCC
CACCTAATAATTGTCTTTCGATTGGCACACATCACACACTTGAGATTTTAATGACTTTTTTTGCGCTATTAGTAACTGTGTTTTTTACAAAACTTTTCACCAACGACTTGTTATCCTTAA
CAAAGATTGTGTAGATAACTTTTATGGTGCTAATAAGCAGCATCATGTTTTTGCAGCGGCGCACACCGTTGGATTCTCTCATTGCGACAGGTTTTCCAATCGGATTTACAGCTTCAGCGC
AGGGAACCCAGTGGACCCCAGTCTGAACAAAACGTATGCAACTCAACTCCAACAGATGTGTCCAAAAAATGTGGACCCCGACATAGCCATCAACATGGACCCAAACACGCCCAGAACCTT
TGACAATGTCTATTTCAAGAATCTTGAACTTGGGCAAGGCCTTTTTACCTCAGACCAGGTCCTTTTCACGGACGCAAGATCTCAGCCCACGGTAAAAACCTGGGCCAAAGACAACGCTGC
TTTTCAACAGGCTTTTATTACCGCGATGACCAAGCTGGGCCGGGTCGGAGTCAAGACCGGTAATAAAGGAAATATTCGTAGCGATTGTAGTGTTCTTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAGGCTCAATCCTATACTCGTTTGGTCGCTTTGCCTTAGTTTGTGCCTCTTTCTCTGTCCCACATCGGCGCAGCTAAAAACAAACTTCTATGCCAACGTCTGCCCCAACGTCGAA
AACATTGTAAAAAATGTTGTCACTCAAAAATTTCAACAAACATTTGTCACAGTCCCAGCAACCATCCGTCTCTTTTTTCATGATTGCTTTGTCCAG
GGTTGTGATGCTTCGGTTTTAGTT
GCTTCCACTGGAAACAACAAAGCAGAGAAGGATCATCCAGATAATCTGTCATTAGCTGGAGATGGTTTTGATACAGTGATCAAAGCCAAAGCAGCAGTTGATGCAGTTCCTCAGTGCAAA
AACAAAGTCTCTTGTGCTGATATTCTTGCCTTGGCCACCAGAGATGTCATTGTTCTG
TCTGGTGGACCTTCGTATGCAGTTGAGTTGGGGAGATTGGACGGACTAAGTTCAAGTTCTAAA
AATGTAGATGGGAACCTCCCCAAGCCAACCTTCAATTTGAACCAGCTCAATTCCATGTTTGCTGCCCATGGGTTGTCCCAGGCTGACATGGTCGCTCTTTCAG
CGGCGCACACCGTTGGA
TTCTCTCATTGCGACAGGTTTTCCAATCGGATTTACAGCTTCAGCGCAGGGAACCCAGTGGACCCCAGTCTGAACAAAACGTATGCAACTCAACTCCAACAGATGTGTCCAAAAAATGTG
GACCCCGACATAGCCATCAACATGGACCCAAACACGCCCAGAACCTTTGACAATGTCTATTTCAAGAATCTTGAACTTGGGCAAGGCCTTTTTACCTCAGACCAGGTCCTTTTCACGGAC
GCAAGATCTCAGCCCACGGTAAAAACCTGGGCCAAAGACAACGCTGCTTTTCAACAGGCTTTTATTACCGCGATGACCAAGCTGGGCCGGGTCGGAGTCAAGACCGGTAATAAAGGAAAT
ATTCGTAGCGATTGTAGTGTTCTTAACTAA

Retrieve as FASTA