Entry information : AtPrx39 (At4g11290 / PER39 / AtperoxP39 / ATP19a / AtP19 / Atatp19a)
Entry ID 205
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-09 (Achraf Jemmat)
Peroxidase information: AtPrx39 (At4g11290 / PER39 / AtperoxP39 / ATP19a / AtP19 / Atatp19a)
Name (synonym) AtPrx39 (At4g11290 / PER39 / AtperoxP39 / ATP19a / AtP19 / Atatp19a)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Mixed tissues
Roots
Roots endodermis
Rosettes
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx39
start..stop
S start..stop
AlyPrx39 647 0 1..326 1..327
CrubPrx89 638 0 1..326 1..326
BstrPrx83 636 0 1..326 1..326
CagraPrx22 619 0 10..326 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6869993..6870202 210 N° 2 6870447..6870641 195 N° 3 6870724..6870886 163 N° 4 6871064..6871476 413
join(6869993..6870202,6870447..6870641,6870724..6870886,6871064..6871476)


exon

Literature and cross-references AtPrx39 (At4g11290 / PER39 / AtperoxP39 / ATP19a / AtP19 / Atatp19a)
Literature REFERENCE 1 Tsukagoshi H, Busch W, Benfey PN. Transcriptional regulation of ROS controls transition from proliferation to differentiation in the root. Cell. 2010 Nov 12;143(4):606-16.
REFERENCE 2 Kim BH, Kim SY, Nam KH. Genes encoding plant-specific class III peroxidases are responsible for increased cold tolerance of the brassinosteroid-insensitive 1 mutant. Mol Cells. 2012 Dec;34(6):539-48.
Protein ref. UniProtKB:   Q9SUT2
DNA ref. Phytozome 11:   Chr4 (6869993..6871476)
mRNA ref. GenBank:   NM_117200
Cluster/Prediction ref. Phytozome Gene 11:   19648416 UniGene:   At.22642
Omic ref. AtProteome:   At4g11290 ATTED-II:   At4g11290 e-FP Browser:   At4g11290 ePlant:   At4g11290 Genevestigator:   At4g11290 TAIR:   At4g11290
Protein sequence: AtPrx39 (At4g11290 / PER39 / AtperoxP39 / ATP19a / AtP19 / Atatp19a)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (303)
PWM (Da):   %s   35463.82 (32959.4)  
PI (pH):   %s   6.98 (6.98) Peptide Signal:   %s   cut: 24 range:24-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTRFGLALLMILVIQGLVTFSEAQLKMGFYDQTCPYAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVRGCDGSILINATSSNQQVEKLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPTWNVPTGRRDGRISNFAEAMNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFNFTGVGDQDPSLDSEYADNLKSRRCLSIADNTTKVEMDPGSRNTFDLSYYRLVLKRRGLFESDAALTMNPAALAQVKRFAGGSEQEFFAEFSNSMEKMGRIGVKTGSDGEIRRTCAFVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns), 4 cDNA and 22 ESTs. Mainly found in roots.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCAAATGCA CACATGACTC TACCTAGCTA GCTAGCTATT CGCATATAGT AAAAAGAAAA GAAAAAAAAA AGTCTATGAA TTGATAAATA GGTTTTTGAA ATTTGAATTA GATTGTATAT  ATGACCCAAC AAAAAATAAT GTCATAGAAC ATATGATGAA ATTCGCTATA CAAATTCTTT TACCCAATGT ATAGTCTAGT TTTGCACCAT ACGTAAATGT TTATTCTTTA ACGTAAAACC  TATATATAGA TTTTTGCGTT TAATTTGAAC TTTATAAGCC ATACAATACG TAACTACATT CGTCAAGATA AGTTGTTTTT GTTAATTATC AACAACCATG ATTTAAAATA TGAAAAAATG  GTTAAGGGTT AGATATATTT TATTTTTTGT TAAAGCAAGG GTTAGATATA TAATATATTA CAAATAACTT CAACTTCATT AAAATACGTC ACATGCCATG ATTTGTCTAC CAAATACAAT  TAATTAACTT ACCGACTTTC TCGACGAAAT TAAAAAAAGT TATCGAAATT ATCATCTGTG TACACCTTTA ATTCCACGAG GAATCTATAT AGGCTAATAA ATAGCCATCG TACGTAACAT  CAAACAAAAT ATATACTAGC TTTGGAATTT TTGTTAGTGT CCTGGCATGG CAAGTTGGAT AAATACAAAG GAAGGTAATA AAAATTAAAA TAGTAATAAA ATTATCACAA ATTTTAGGTA  TATAGATCTC CATATCTATA ACAAACATAT AACATGTTAA GAATAAATAA AAAAGACGAA ACCACCAAGC AAATTCTAAA GATCGTTGGT TTGAATGACA TTAGGAAGGA AATGATAGTA  AATATACTAG TTCTCGAGAA AATGTAGGGA TTTAAGCTTA GAACATCTTA ATTATTCAAA AATAATAATT GAAAACCACA TAAAATTATA AATCTTGCCT AATAGTTAAT ATTGAGACTA  AAACTCAAAC TTTTTTTTTT TCTTTGGTTT TACTTTTTTG ATTATATAGA TAAATGGATG ATGATTAATA GTTTTGTTGG AGATGATTTT TTGCTACCAA ATATAGACAC GAGTTATGGC  TCTATTGTCT CTCACATAAA AACGTTAAAC GTTCTACTAA AGGTGGCATG AATCCTATGC ATTTTGGAAC TGACAATATT CAGTTGTCTC TAATAGATAA CTAAGACTTA TAACTTTAAT  CTCCATTTTT TTTTCCGCGA ATCAGGATCG GTTATGACTA AAGCGTTAAA CAGTCTCTAT TAGGACAAAC CTAATTTTGT TTTCCAATAA GTTATTTCAG TTAACCTTGC TACTATCGCA  TATCGTTACC CTTCGGTAAG GTGGTTGGGA AGCTTTGATC ATTCCCATGC GGACAAACCA GCTACAGTTA CTCTAGAGCA CTCAACATTC CATCGAAAAA CAATTCAACC ATTAAGAAGA  TCTCCAAAAA TCTGGCTCGA ACAAACTTTT AAAATATTTG TTAATTAATT TTATTATTCA ATCTCAGTTA GTATAGTTTT ATGTAAATTC AACTAGTCTT CATACTTATT TTCTATCTTC  ATTAAGTAAT AATACATTAG TTTTGGTAGA ATTAGTTTTT GTCTGGCTTT ATAAGCTAGT TAGTTTAATT TACAATATTA TTTTCAAAAT CATTTGATTT TATCTATTCA TGTACTTATT  TGTTTAAATT TTATTAACAT TTGGAGAGAA TCTATTTTTT TCTTAATTAT ATAGATTATT TACCATAACT ATATCAATAT TTCCTTAAGA ACACATTAGA TTATAATAAT AACAATAAGA  AAAGACAAGG CAATAGTATC TTTATGATGA TAATTGAAAT CAAACAGGAA TAAATAGAAC ATGTTTGGTA GCTTCTTTCT TCTTGTTCTC TTCTCCACAT TGCTTTATCC TCTCACGACC 
AACACTATAT ATAATCCCTA ACTTGGGAAC TCTTATCCTC CAAACATAGT TAAACCAAAT TTTCTAAGTG TCTCATAAAA A 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAGTGTTTCT TACTTTTTCT TTCGCAACTT TTTTGTTTTG TTTTAAATAT CTTTTATATT GGTTTTTATG TTCCTTTTGT CAACTTTTTT GGGTGTTTGG AAGAATTTCG AGATATGTAT  TATTGTATGT GGTGAATATG TGATTTTCAA ATAAATTTCA CGTCTGTGAA AATCGTTGAA CTAAATTTTC CACCAATTTA TTTTTCAATA AAAATTTGCT TTAGCTTTAG ATTTTTTTTT  CTAAAAAAGC AATAGATAAA TTTGTATAAT ATAACAGAAA TGTTTCTAAT ATAAATTAAA TTGGGCCATG ACCCAAAAGA ATAAGCTCAA GGTTGGAACA AAAACTATAT TACGCTGAAT  AAAGCCCATT GGTCTTCTAG TGTTATCTGC GATTTCCGAT TTGGGTGATT CATCAGTGTT TGCTTCTCTA CTCAAATTTA CCATTGATAA CACACAAGCG TAACTTAGTG TTAGACTGTG  TGTGAGAACC TTTACATAAG AAGACTTTAT ATTAATTACC GATTTACCTA AGAACTTTTA TATCTCTCGA ATATTACATA AACGTCAGTG TGAAAAAAAT AAAGACTCAA ATTTATTTGT  CTTCAAATGT TTTTTCCATT GATGAAAGAT AATTAGAACA TCAAAATGGC TTGGTGTAGT CTACTCACAA TATTGACAAT AGTTTTGCAA TCTTAGTATT AAACATGGTG TATACATTAT  CTTTCTTTAA TTACGAATTG TAATTTATAT ACATCAAAGA TTATCACATA AATAAAACAA TAAAAACCTG TAATTTGTTC TCTTTTCTTA ATCAAAAGAG TTAACTCAAA GATTAAATTT  TCACAACAAC AAAGTTAAAA GATTACAATC AGTGATCAAT CACTTCAAGT ATCTCACTTC TGCTTTTCAC CAACCTATGA AACACTTCTC TAACTCTTCT CTGTAACCCC TCAAGCCCAT 
CTTCCATTTT CCGGCAAATC TCCTCCATCT CCGCCACTTC 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAGATTCGGATTAGCTCTTTTGATGATTCTTGTGATTCAAGGGCTTGTGACCTTTTCAGAAGCACAATTGAAGATGGGATTCTACGACCAAACGTGCCCTTACGCAGAGAAGATC
GTACAAGATGTTGTCAACCAACATATAAACAATGCACCCTCTTTGGCTGCTGGCCTAATTAGGATGCATTTTCATGACTGCTTCGTTCGG
GTATTCTTCTTTTGTTTTAAATAACTTCAT
CGTATACTTATTATCATACGTATTACCTACCAATACAAACAATTTTAAAACATTGTGTGTTAAAATCATCAAAACAATTCAGAGGGTTTAACAGAAAAAATAAAAATATTTAAGATGTTT
TATTTTAGCCATGCATTAATCATATAGTATATGCGAAAACGTATATTTTTCTATATAGATAGCTAAATTAGTATGTATATATCGGTGTTGACAGGGTTGTGATGGTTCCATCTTGATCAA
CGCGACATCGAGCAACCAACAAGTGGAGAAGCTTGCTCCTCCGAATCTAACTGTGAGAGGTTTCGATTTTATCGATAAAGTAAAGTCTGCTCTAGAATCAAAGTGCCCTGGAATCGTCTC
TTGCGCTGATATCATCACACTTGCTACTAGAGACTCTATTGTTGCTATT
GTGAGTATGCTAATACCCCTTGTTTTGTCTAAACTCTAAACCTGATACAAAAACTAACCGGTTTCGAATAA
TTTTGGCTTAGGGTGGACCGACATGGAACGTTCCAACGGGGCGCAGAGACGGACGTATCTCTAACTTTGCCGAGGCTATGAACAATATTCCTCCTCCTTTCGGAAACTTCACGACTCTGA
TAACCCTCTTTGGAAACCAAGGACTTGATGTTAAAGACCTCGTCTTGTTATCCG
GTAATATTTAACTCCAAATTGTCTTCTGTTTTTTTGAATCGGTTTAAGTAACTTGGGATATAAATT
TGGTTGAGGTAAGTAGTAGAAAAAAAACGCTGCGGTTTGATTTACGTGTTTTATTTCAATACGTCGTCGTTTTTACTTATAGTATTTAAAGAGTAATTTTGAACGTTTTAGGTGCCCACA
CGATTGGAGTGTCTCATTGCTCCTCCTTCTCAAACCGTCTCTTCAATTTCACCGGCGTTGGAGACCAAGATCCATCGCTCGACAGCGAATATGCCGACAATCTCAAATCACGGAGATGTT
TATCTATCGCTGACAATACCACAAAAGTCGAAATGGATCCCGGTAGTCGAAACACCTTCGATCTTAGCTACTACCGTCTTGTCCTAAAACGTCGTGGACTTTTTGAGTCTGACGCTGCAT
TGACTATGAATCCTGCGGCATTGGCTCAGGTCAAACGCTTCGCCGGAGGATCGGAGCAAGAGTTCTTTGCTGAGTTCTCCAACTCCATGGAGAAAATGGGAAGGATTGGGGTCAAAACAG
GGTCGGATGGGGAGATTCGAAGAACATGTGCATTTGTTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAGATTCGGATTAGCTCTTTTGATGATTCTTGTGATTCAAGGGCTTGTGACCTTTTCAGAAGCACAATTGAAGATGGGATTCTACGACCAAACGTGCCCTTACGCAGAGAAGATC
GTACAAGATGTTGTCAACCAACATATAAACAATGCACCCTCTTTGGCTGCTGGCCTAATTAGGATGCATTTTCATGACTGCTTCGTTCGG
GGTTGTGATGGTTCCATCTTGATCAACGCG
ACATCGAGCAACCAACAAGTGGAGAAGCTTGCTCCTCCGAATCTAACTGTGAGAGGTTTCGATTTTATCGATAAAGTAAAGTCTGCTCTAGAATCAAAGTGCCCTGGAATCGTCTCTTGC
GCTGATATCATCACACTTGCTACTAGAGACTCTATTGTTGCTATT
GGTGGACCGACATGGAACGTTCCAACGGGGCGCAGAGACGGACGTATCTCTAACTTTGCCGAGGCTATGAACAAT
ATTCCTCCTCCTTTCGGAAACTTCACGACTCTGATAACCCTCTTTGGAAACCAAGGACTTGATGTTAAAGACCTCGTCTTGTTATCCG
GTGCCCACACGATTGGAGTGTCTCATTGCTCC
TCCTTCTCAAACCGTCTCTTCAATTTCACCGGCGTTGGAGACCAAGATCCATCGCTCGACAGCGAATATGCCGACAATCTCAAATCACGGAGATGTTTATCTATCGCTGACAATACCACA
AAAGTCGAAATGGATCCCGGTAGTCGAAACACCTTCGATCTTAGCTACTACCGTCTTGTCCTAAAACGTCGTGGACTTTTTGAGTCTGACGCTGCATTGACTATGAATCCTGCGGCATTG
GCTCAGGTCAAACGCTTCGCCGGAGGATCGGAGCAAGAGTTCTTTGCTGAGTTCTCCAACTCCATGGAGAAAATGGGAAGGATTGGGGTCAAAACAGGGTCGGATGGGGAGATTCGAAGA
ACATGTGCATTTGTTAACTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAACATAGTT AAACCAAATT TTCTAAGTGT CTCATAAAAA ATGACGAGAT TCGGATTAGC TCTTTTGATG ATTCTTGTGA TTCAAGGGCT TGTGACCTTT TCAGAAGCAC AATTGAAGAT  GGGATTCTAC GACCAAACGT GCCCTTACGC AGAGAAGATC GTACAAGATG TTGTCAACCA ACATATAAAC AATGCACCCT CTTTGGCTGC TGGCCTAATT AGGATGCATT TTCATGACTG  CTTCGTTCGG GGTTGTGATG GTTCCATCTT GATCAACGCG ACATCGAGCA ACCAACAAGT GGAGAAGCTT GCTCCTCCGA ATCTAACTGT GAGAGGTTTC GATTTTATCG ATAAAGTAAA  GTCTGCTCTA GAATCAAAGT GCCCTGGAAT CGTCTCTTGC GCTGATATCA TCACACTTGC TACTAGAGAC TCTATTGTTG CTATTGGTGG ACCGACATGG AACGTTCCAA CGGGGCGCAG  AGACGGACGT ATCTCTAACT TTGCCGAGGC TATGAACAAT ATTCCTCCTC CTTTCGGAAA CTTCACGACT CTGATAACCC TCTTTGGAAA CCAAGGACTT GATGTTAAAG ACCTCGTCTT  GTTATCCGGT GCCCACACGA TTGGAGTGTC TCATTGCTCC TCCTTCTCAA ACCGTCTCTT CAATTTCACC GGCGTTGGAG ACCAAGATCC ATCGCTCGAC AGCGAATATG CCGACAATCT  CAAATCACGG AGATGTTTAT CTATCGCTGA CAATACCACA AAAGTCGAAA TGGATCCCGG TAGTCGAAAC ACCTTCGATC TTAGCTACTA CCGTCTTGTC CTAAAACGTC GTGGACTTTT  TGAGTCTGAC GCTGCATTGA CTATGAATCC TGCGGCATTG GCTCAGGTCA AACGCTTCGC CGGAGGATCG GAGCAAGAGT TCTTTGCTGA GTTCTCCAAC TCCATGGAGA AAATGGGAAG  GATTGGGGTC AAAACAGGGT CGGATGGGGA GATTCGAAGA ACATGTGCAT TTGTTAACTA AAAGTGTTTC TTACTTTTTC TTTCGCAACT TTTTTGTTTT GTTTTAAATA TCTTTTATAT  TGGTTTTTAT GTTCCTTTTG TCAACTTTTT TGGGTGTTTG GAAGAATTTC GAGATATGTA TTATTGTATG TGGTGAATAT GTGATTTTCA AATAAATTTC ACGTCTGTGA AAATCGTTGA 
ACTAAA 

Retrieve as FASTA