Entry information : AtPrx43 ( At4g25980 / PER43 / AtperoxP43)
Entry ID 209
Creation 2006-06-15 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-03-30 (Catherine Mathe)
Peroxidase information: AtPrx43 ( At4g25980 / PER43 / AtperoxP43)
Name (synonym) AtPrx43 ( At4g25980 / PER43 / AtperoxP43)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Endoderm
Seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx43
start..stop
S start..stop
AlyPrx43 627 0 1..326 1..326
CagraPrx52 625 0 1..326 1..326
AhalPrx42 624 0 1..326 45..370
BstrPrx30 614 0 1..326 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13189528..13189740 213 N° 2 13189815..13189997 183 N° 3 13190079..13190241 163 N° 4 13191086..13191507 422
join(13189528..13189740,13189815..13189997,13190079..13190241,13191086..13191507 )


exon

Literature and cross-references AtPrx43 ( At4g25980 / PER43 / AtperoxP43)
Protein ref. UniProtKB:   Q9SZH2
DNA ref. Phytozome 11:   Chr4 (13189528..13191507)
mRNA ref. GenBank:   NM_118731
Cluster/Prediction ref. Phytozome Gene 11:   19643742 UniGene:   At.50365
Omic ref. AtProteome:   At4g25980 ATTED-II:   At4g25980 e-FP Browser:   At4g25980 ePlant:   At4g25980 Genevestigator:   At4g25980 TAIR:   At4g25980
Protein sequence: AtPrx43 ( At4g25980 / PER43 / AtperoxP43)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326
PWM (Da):   %s   35228.04  
PI (pH):   %s   5.76
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVWANAKMRLALSLVTVFFGISLANLEVGFYSNTCPQAESIVKRVVSGAALSDPNLPAILLRLHFHDCFVEGCDGSILVNNGAISEKNAFGHEGVRGFEIVEAVKAELEAACPGVVSCSDIVALAARDAISLANGPAYEVPTGRRDGRVSNMSLAKDMPEVSDSIEILKAKFMQKGLNAKDLVLLSAAHTIGTTACFFMSKRLYDFLPGGQPDPTINPTFLPELTTQCPQNGDINVRLPIDRFSERLFDKQILQNIKDGFAVLQTDAGLYEDVTTRQVVDSYLGMLNPFFGPTFESDFVKAIVKMGKIGVKTGFKGEIRRVCSAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns), no EST. Additionnal residus in N-term in Phytozome and TAIR
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGCCCTCCTT TTGTAAGTTT AGATGAACTG AAAATTGAAT TATGTACTTG TTGCAGGATC AAATAAACAT GGCCGAAGTC AAGTATCCTC TGGACCATTT TAAGGTACGC AAAGGCAACT  CATGGTATGA TTTCAACCAC GAGATTACAA TAGAAGTGTT AGTAGTTATA AAATAAATAT GTAAGTGACA CTGAGGTAAA TCTAAGCTAA ACTTTTTGCC GGTTTTATCA AAGATGGGAA  AAACCCTTTA TAATTTGGTT TAACTATAAA GCTTGTGTAC TTTTCATGGA TTTGAAAGGT GGTCATTTTA CTTGCAGACG TTCAATGAAT TCTTCGTACG GGAGTTAAAG CCTGGTGCAA  GACCAATTGC GTGCATGGAT CAGGATGATG TTGCTGTATC TGCTGCTGAT TGTCGATTAA TGGCATTTCA ATCGGTTGAT GATAGCACAC GGTTCTGGAT CAAGGTAAAG CGGCCTCTAG  AGTATTCACA ATACACTAGG CAAGGCATAT GAAAAGTTGA ATAACTCTTA ACACAATTGA TGCTGCTGAT AACCTGCAAC ACTGTACAAC TGTTACTCGC TATTCTAAAA TTTTCAGACT  GTTTTCAATA TTGTTAGGGC CGTAAGTTTT CAATCAAAGG CCTCCTTGGA AATGATGTGC AGTCGGATGC TTTCCTTGAT GGATCTTTGG TGATATTCCG ATTGGCGCCA CAGGTACAAG  AGGACTCCAT GCTTCTTGTC GTTTGATCAA AAGCTAAAAA TTAACACTTG TTTCGCTCTC TTTTTGCATT TATTGATCTA TTACAGGACT ATCATCGTTT TCATTCTCCT GTCTCTGGTG  TCATTGAAAA GTTTGTCAAT GTTTCTGGAA GCTTATATAC GGTATTGCAT CTGCCTTTTC ACGTTGAAGA GCATTCTTCT CTTCCGTTAT TTTCTTATTG GAGTTACTTT TGTATCCTTG  GTTCTCAGGT TAATCCGATT GCTGTCAATA GCAAGTACTG TAATGTGTTC ACTGAGAATA AACGGACCAT CGTAATTATA TCAACAGCAG AGTTTGGAAA GGTATGTCAT CTTGTATAAG  TCATAAACAT CTTTTTTCTC GGTCTGCTGA TGAAAATATT TCTCAGTTGC CTCTTGTGCT TGATGCTTTG AACTCAAATT GAAGCAGTAT TTTATAAACG AAGGTGTACA ATGAAATCTG  ATCTTATCGC AGAACTTGAT CTCAGCTTAA TATATGTAAC AGGTCGCATT TGTTGCGATT GGAGCAACAA TGGTTGGTAG TATCAGCTTT GTTAGGCAAG AGGGAGACCA TGTGAAGAAA  GGGGACGAGG TAATCAATTC TGAACCTTTT TTCTAATTGA AAGATATGTC ATTCTTTCTT ATGCAATTCT AAACTAGCAT TCTCCTTTTT CCAGCTTGGT TACTTTTCAT TTGGTGGAAG  CACAGTTATA TGCGTCTTTG AAAAGGTTAG CTTTTAACTT TGTTTTTCTT ACAGTACCCT AGAAATGAAT TGTCTTGATT TGAAAATCTT GTGACAAAAT ATCTTACATT TTTGTAATAC  TGTCCCTGGA TGAGTTATTG CATTTACATC AACCTTACCT TTCACGTGAC ATGTATTACA GGACTCGATT AAGATTGATG AGGATCTCTT AGCTAACAGT GCTAGGTCCT TGGAGACATT  AGTTACTGTT GGAATGCAAC TTGGTGTCTC CTTTCCAAAG CTGGAAAACT GTGTACTTGA GCCCTGAACT GCTTCAAACT ATGTGAGTTA GTACGAAACG ACAGATGATT TTCTATGGTT  TGGTTTGATT TGATTTAGTT TTCACTTTTC ATCAAGAAAG AACTCAATTC CTCTCTGTTT AATACACAAT GACTTTGCTC TGTATATATA AACACCAGTA TGTCCCGGGC AGTGATACTT 
GTTAATGTTT ACGGTATTTC GCTTTTTTTG TTGAGTGTTT TTCCTAGGTG ACAATTTTAC ATGCAAATAA GGTTAAACAC 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGAGTATGT AATGAAATTG AAACTGTATA ATTTCTTTTG CTCAAACAAT GTTTTGACTC CATAATATGT GTAGGCAAAA AAGCCTCTCA AACTCTGAAT GAATACTAAA AAACAAAGAG  AGTATTAATG CATGGAATTG AAAAAGTACA AATTCTAGAG AGGATGCAAA ACAATTATAA AGAGAGTTGA ATGTACGATT TTCCACTACA TCCTTGGCGT TAATAGTGTA CATGTATGAA  TTCTGAAGTC TCAACATGTA GTTTTTACCA AAAGACAAAA TAAAGTTGTA TTCGTTATAA TTCTTAGCTG TCTCGAATCA ACTAATTTCT TCCCCCATTC CCTTATGACA AAAAAAAAAC  CTAGGCTATT AAAAGAACGA ACAAAACAAA AAGAGAATCA AAGAGCTTAA GTTCTTTCGG CTCTTATTCT TATAATCGTA GACCACTTAA ATTCCTTGCG TTGGGCCTTC TCACAAATCG  TCCCTGTTGA TGAGAGACAA CCACAATATT ACAATGCCAA TCTTTCACCT AAATCGTAGC TCAAATAAAA TGTATCAGCG TTACCTTCAT TCTACCCTTG TTGACAGTAT TATATATATA  AGTTTCAACT TTTACATTTT TCAAGACTAT GAGATTTATA CCTTCATACG CGGGCGTTGG TCGGCGTTGA GCTTGCGAAC TTGATATCGG ATTTTCTTGG AGAAGAGTCT ATTCCTCCGC  TTCTCTTTAT ACCTTAACAC ACTTGCTTCT CTCATACCAC TTTCTCCGAA CAAATCTATC TCACCCAACC TTACCTGTCC CCAAACATCA TTCATCTTAC GTCAAATTCA CTCACTAAAT  TGTCAACTAA ATTCACTTGA TAATCTACTT CTAACAAAAC ATTGTAAGTC AGAAATGACA AGAACTACAT AAGAACCATT TTCAATTCTT GTCAGGTTCA GAAATTCATA ATGAATTGTT 
TGTTGCCAAC AATTGGTCAT CAAAACGTTT TTATTTCGAT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTGGGCAAATGCTAAGATGAGGCTAGCTTTGTCTCTTGTTACGGTTTTCTTCGGCATCTCTCTTGCTAATCTTGAAGTCGGATTTTACTCCAATACATGCCCTCAAGCCGAGTCA
ATCGTTAAGAGGGTTGTCTCAGGGGCTGCTCTTTCCGACCCTAACCTCCCAGCCATACTTCTACGGCTCCATTTCCATGATTGCTTTGTTGAG
GTACAATGCACTTTCCTCCCCTTCGTG
CTTTCTACTATTGCTTGCTATTCTTAGAGATTTAACCACACGTTCAGGGATGTGATGGCTCGATCCTCGTGAACAACGGAGCAATCTCTGAAAAGAATGCATTTGGACATGAAGGCGTTA
GAGGATTTGAGATAGTAGAAGCCGTCAAAGCCGAGCTTGAAGCTGCATGCCCCGGTGTTGTCTCCTGCTCAGACATTGTTGCCTTGGCTGCACGTGATGCCATATCTTTG
GTAAAAAATA
AAATAGAGAAAGAAAAAAACCTTTCCATCTTTATCTATCTTCTTCTCCGTTGTGAGCAATTCATGATACAGGCGAATGGACCGGCGTATGAGGTGCCAACTGGGCGGAGAGATGGTCGGG
TTTCGAACATGTCATTGGCTAAGGACATGCCGGAGGTGAGTGACTCGATTGAGATACTAAAGGCTAAGTTCATGCAGAAAGGACTCAACGCCAAAGACCTCGTGCTTCTCAGTG
GTATGT
ATCTCTTCTTCTTCTTCGTCTTCTCTCTCATTCATGTTTGTTTGGTGGTTTCGAATCTCTCAAAGTTTTTGGTTCGAAGTTCAAGTTATATGATTTTCAATTCCCGGATCCATGATACGT
TTCGCATGTTTCGTCCGTTTCCTCTCTTCTTCGTGTGTTAGTGTCACGTGCGTTAGGAAATTCTGGTAGACCAATACAAGAAAACATTATTGGAATTTTTTCCAGCTAAGCCAGCAGTGT
TTCTTTGTGCAGAAAAATAATTTCGTGAAATTTAAAATTTTAAACTTGTGAGAATTTTCTTCTAACGATAACAAATTATCCAATATTTACCTATACGTTGCGAAACTTAAAGAATCGTTC
GTAATAAAAAAAAATCAGGCTTTTTGGGTCAACTTTAGGCATTTATACAAATGTTTTGATGTTCTGTCATCTTAACCACTAAATCTGGTATAGCACAGAAATGTTGATTCACCCCGAAAA
TGGGCCTGTTACACGATCGGCAATTAATCTGATAAAACGTCATAAATATCTAACGGCCCCATTCTATAGAGTATTGATTTTTTTTTATTTTTATTTTCATCAAAAACCAATACTGATCTC
GATACGATCGTGAAATTATCAACTTTCACGTGTGACTAAACAAAGACGAAACCATCAACATGCTGAGTCTAAGCCAGTAGTGATCATGCATTTTGAACCTGGTCCGGCTCAGTTTGCGTC
ATTTTTTTATTTAGTTTACATTTCAAGTTTCAATATGAGAAAACTTTGACAAAAAAAATTGTCACTAGTTTTAAGAATTTAAGAGATCTAAACCTGAGTGGTCTACTTTCCGTATCAGCT
GCTCACACTATCGGAACAACGGCCTGCTTCTTCATGTCCAAACGGCTCTATGATTTCTTACCTGGTGGCCAACCTGACCCGACTATCAATCCAACATTCCTACCCGAATTAACCACTCAG
TGCCCACAAAATGGTGACATAAACGTCCGTTTACCAATTGACCGGTTCAGCGAACGGCTATTCGACAAGCAGATTCTGCAAAACATAAAGGATGGTTTTGCTGTGCTTCAGACCGACGCA
GGTCTTTACGAGGATGTAACGACCAGACAGGTCGTGGATTCCTATCTTGGGATGCTAAATCCATTCTTTGGGCCAACATTCGAGTCTGATTTCGTTAAGGCGATCGTAAAGATGGGGAAG
ATTGGTGTGAAGACTGGTTTCAAAGGGGAGATTCGACGGGTTTGCTCGGCCTTCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTGGGCAAATGCTAAGATGAGGCTAGCTTTGTCTCTTGTTACGGTTTTCTTCGGCATCTCTCTTGCTAATCTTGAAGTCGGATTTTACTCCAATACATGCCCTCAAGCCGAGTCA
ATCGTTAAGAGGGTTGTCTCAGGGGCTGCTCTTTCCGACCCTAACCTCCCAGCCATACTTCTACGGCTCCATTTCCATGATTGCTTTGTTGAG
GGATGTGATGGCTCGATCCTCGTGAAC
AACGGAGCAATCTCTGAAAAGAATGCATTTGGACATGAAGGCGTTAGAGGATTTGAGATAGTAGAAGCCGTCAAAGCCGAGCTTGAAGCTGCATGCCCCGGTGTTGTCTCCTGCTCAGAC
ATTGTTGCCTTGGCTGCACGTGATGCCATATCTTTG
GCGAATGGACCGGCGTATGAGGTGCCAACTGGGCGGAGAGATGGTCGGGTTTCGAACATGTCATTGGCTAAGGACATGCCGGAG
GTGAGTGACTCGATTGAGATACTAAAGGCTAAGTTCATGCAGAAAGGACTCAACGCCAAAGACCTCGTGCTTCTCAGTG
CTGCTCACACTATCGGAACAACGGCCTGCTTCTTCATGTCC
AAACGGCTCTATGATTTCTTACCTGGTGGCCAACCTGACCCGACTATCAATCCAACATTCCTACCCGAATTAACCACTCAGTGCCCACAAAATGGTGACATAAACGTCCGTTTACCAATT
GACCGGTTCAGCGAACGGCTATTCGACAAGCAGATTCTGCAAAACATAAAGGATGGTTTTGCTGTGCTTCAGACCGACGCAGGTCTTTACGAGGATGTAACGACCAGACAGGTCGTGGAT
TCCTATCTTGGGATGCTAAATCCATTCTTTGGGCCAACATTCGAGTCTGATTTCGTTAAGGCGATCGTAAAGATGGGGAAGATTGGTGTGAAGACTGGTTTCAAAGGGGAGATTCGACGG
GTTTGCTCGGCCTTCAATTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTGGG CAAATGCTAA GATGAGGCTA GCTTTGTCTC TTGTTACGGT TTTCTTCGGC ATCTCTCTTG CTAATCTTGA AGTCGGATTT TACTCCAATA CATGCCCTCA AGCCGAGTCA  ATCGTTAAGA GGGTTGTCTC AGGGGCTGCT CTTTCCGACC CTAACCTCCC AGCCATACTT CTACGGCTCC ATTTCCATGA TTGCTTTGTT GAGGGATGTG ATGGCTCGAT CCTCGTGAAC  AACGGAGCAA TCTCTGAAAA GAATGCATTT GGACATGAAG GCGTTAGAGG ATTTGAGATA GTAGAAGCCG TCAAAGCCGA GCTTGAAGCT GCATGCCCCG GTGTTGTCTC CTGCTCAGAC  ATTGTTGCCT TGGCTGCACG TGATGCCATA TCTTTGGCGA ATGGACCGGC GTATGAGGTG CCAACTGGGC GGAGAGATGG TCGGGTTTCG AACATGTCAT TGGCTAAGGA CATGCCGGAG  GTGAGTGACT CGATTGAGAT ACTAAAGGCT AAGTTCATGC AGAAAGGACT CAACGCCAAA GACCTCGTGC TTCTCAGTGC TGCTCACACT ATCGGAACAA CGGCCTGCTT CTTCATGTCC  AAACGGCTCT ATGATTTCTT ACCTGGTGGC CAACCTGACC CGACTATCAA TCCAACATTC CTACCCGAAT TAACCACTCA GTGCCCACAA AATGGTGACA TAAACGTCCG TTTACCAATT  GACCGGTTCA GCGAACGGCT ATTCGACAAG CAGATTCTGC AAAACATAAA GGATGGTTTT GCTGTGCTTC AGACCGACGC AGGTCTTTAC GAGGATGTAA CGACCAGACA GGTCGTGGAT  TCCTATCTTG GGATGCTAAA TCCATTCTTT GGGCCAACAT TCGAGTCTGA TTTCGTTAAG GCGATCGTAA AGATGGGGAA GATTGGTGTG AAGACTGGTT TCAAAGGGGA GATTCGACGG 
GTTTGCTCGG CCTTCAATTG A 

Retrieve as FASTA