Entry information : CsaPrx06 (Cucsa.153390.1 / CUSPREPERB)
Entry ID 21
Creation 2006-03-23 (Christophe Dunand)
Last sequence changes 2011-12-13 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx06 (Cucsa.153390.1 / CUSPREPERB)
Name (synonym) CsaPrx06 (Cucsa.153390.1 / CUSPREPERB)
Class Class III peroxidase    [Orthogroup: Prx161]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx06
start..stop
S start..stop
CsaPrx07 411 1e-145 1..322 1..318
CsaPrx42 374 2e-130 9..322 7..327
IbPrx05 373 2e-130 10..322 5..327
CsaPrx55 372 8e-130 1..322 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 512719..512928 210 N° 2 512428..512616 189 N° 3 512159..512327 169 N° 4 511437..511837 401
complement(join(511437..511837,512159..512327,512428..512616,512719..512928))


exon

Literature and cross-references CsaPrx06 (Cucsa.153390.1 / CUSPREPERB)
Literature Rasmussen,J.B., Smith,J.A., Williams,S., Burkhart,W., Ward,E.R., Somerville,S.C., Ryals,J. and Hammerschmidt,R.1992 unpublished
Protein ref. UniProtKB:   Q40559
DNA ref. Phytozome 12:   scaffold01124 (512928..511437)
mRNA ref. GenBank:   M91372
Protein sequence: CsaPrx06 (Cucsa.153390.1 / CUSPREPERB)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (299)
PWM (Da):   %s   34161.65 (31785.4)  
PI (pH):   %s   4.77 (4.57) Peptide Signal:   %s   cut: 24 range:24-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSKVIVSLVLCLMMAVSVRSQLSSTFYDTTCPNVSSIVHGVMQQALQSDDRAGAKIIRLHFHDCFVDGCDGSVLLEDQDGITSELGAPGNGGITGFNIVNDIKTAVENVCPGVVSCADILALGSRDAVTLASGQGWTVQLGRRDSRTANLQGARDRLPSPFESLSNIQGIFRDVGLNDNTDLVALSGAHTFGRSRCMFFSGRLNNNPNADDSPIDSTYASQLNQTCQSGSGTFVDLDPTTPNTFDRNYYTNLQNNQGLLRSDQVLFSTPGASTIATVNSLASSESAFADAFAQSMIRMGNLDPKTGTTGEIRTNCRRLN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 mRNA.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCTTCTAAAGTTATTGTTTCTTTGGTACTGTGTTTGATGATGGCTGTGTCTGTGAGATCTCAGCTTAGCTCCACCTTCTATGACACTACATGTCCTAACGTATCAAGCATT
GTGCATGGTGTTATGCAGCAAGCTCTTCAAAGTGACGATAGAGCCGGTGCCAAAATCATCCGTCTCCATTTTCACGATTGTTTCGTCGAC
GTAAGTTGCTGTCTTACTCTCTTTGCTGAC
TTTTTAATTAAAAGAGTTTGTAAGTTGAAAGGATTATGATGTAATCAAATAATTATTGTTGTATATTTGCAGGGTTGTGATGGGTCGGTGCTACTCGAGGACCAAGATGGTATAACGAGT
GAGTTGGGTGCACCTGGAAACGGAGGCATCACGGGTTTCAATATTGTTAATGACATCAAAACCGCAGTTGAGAATGTTTGTCCAGGAGTCGTTTCATGTGCTGACATTCTAGCCCTTGGT
TCTAGAGACGCAGTCACCTTG
GTACCTAACTATTCCAACCTAATTACCATTTTAGGTTAATTAACTCATTTAATAACACAAGCTAATTAAGCACATATATATGTGTTGAATAATTTTGTA
GGCATCAGGACAGGGTTGGACGGTTCAATTGGGAAGAAGAGACAGTAGAACAGCAAATTTGCAAGGAGCCAGGGATAGGCTCCCAAGTCCTTTTGAGAGTCTCTCCAACATCCAAGGTAT
ATTCAGAGATGTTGGTCTTAACGATAATACCGATCTCGTTGCTCTATCAG
GTAATCAATATTGATAGCTCGTATGGTATAAAAATATATTATTTGTCATGTGGTAATTAAATATGAATTG
AACGACAACCAAGATATAACGTTAAATATTTTTCACACATGCATATATATCACCTTTTTATCTCAATTGTTAAACCCTCTCTTTGAGTTTATTTAATTAAAAAGGACGTGTTTCATGCAT
CTTTTAACATGCAGTACACGTATTTGAGTTTGTCATATGTCAAATTATGAATAAATAATCTAGTAAGATACATATACAAAATTAGTTTTACGTACAAATGATTAAATATTTTTATGGTAT
ACACTTTGCAGGTGCACACACATTCGGGCGTTCAAGATGCATGTTTTTCAGCGGACGCCTAAACAATAATCCAAACGCAGATGACTCACCCATAGACTCGACATACGCGAGTCAGTTGAA
CCAAACTTGTCAATCAGGGTCAGGCACATTCGTGGATTTGGACCCGACGACGCCAAACACATTCGATAGAAACTACTACACAAACCTTCAGAACAACCAAGGGCTTTTGAGAAGTGACCA
AGTTCTGTTCTCCACTCCAGGAGCTTCAACTATCGCTACTGTCAACAGCTTAGCCAGCAGCGAGAGCGCATTTGCTGACGCCTTCGCTCAATCAATGATCAGGATGGGAAATCTCGACCC
TAAGACTGGAACCACCGGAGAAATCAGAACCAATTGTAGAAGACTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCTTCTAAAGTTATTGTTTCTTTGGTACTGTGTTTGATGATGGCTGTGTCTGTGAGATCTCAGCTTAGCTCCACCTTCTATGACACTACATGTCCTAACGTATCAAGCATT
GTGCATGGTGTTATGCAGCAAGCTCTTCAAAGTGACGATAGAGCCGGTGCCAAAATCATCCGTCTCCATTTTCACGATTGTTTCGTCGAC
GGTTGTGATGGGTCGGTGCTACTCGAGGAC
CAAGATGGTATAACGAGTGAGTTGGGTGCACCTGGAAACGGAGGCATCACGGGTTTCAATATTGTTAATGACATCAAAACCGCAGTTGAGAATGTTTGTCCAGGAGTCGTTTCATGTGCT
GACATTCTAGCCCTTGGTTCTAGAGACGCAGTCACCTTG
GCATCAGGACAGGGTTGGACGGTTCAATTGGGAAGAAGAGACAGTAGAACAGCAAATTTGCAAGGAGCCAGGGATAGGCTC
CCAAGTCCTTTTGAGAGTCTCTCCAACATCCAAGGTATATTCAGAGATGTTGGTCTTAACGATAATACCGATCTCGTTGCTCTATCAG
GTGCACACACATTCGGGCGTTCAAGATGCATG
TTTTTCAGCGGACGCCTAAACAATAATCCAAACGCAGATGACTCACCCATAGACTCGACATACGCGAGTCAGTTGAACCAAACTTGTCAATCAGGGTCAGGCACATTCGTGGATTTGGAC
CCGACGACGCCAAACACATTCGATAGAAACTACTACACAAACCTTCAGAACAACCAAGGGCTTTTGAGAAGTGACCAAGTTCTGTTCTCCACTCCAGGAGCTTCAACTATCGCTACTGTC
AACAGCTTAGCCAGCAGCGAGAGCGCATTTGCTGACGCCTTCGCTCAATCAATGATCAGGATGGGAAATCTCGACCCTAAGACTGGAACCACCGGAGAAATCAGAACCAATTGTAGAAGA
CTCAATTAA

Retrieve as FASTA