Entry information : AtPrx44 (At4g26010 / PER44 / AtperoxP44 / ATP35)
Entry ID 210
Creation 2006-01-26 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-05 (Achraf Jemmat)
Peroxidase information: AtPrx44 (At4g26010 / PER44 / AtperoxP44 / ATP35)
Name (synonym) AtPrx44 (At4g26010 / PER44 / AtperoxP44 / ATP35)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Roots
Rosettes
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx44
start..stop
S start..stop
AlyPrx44-1 564 0 1..310 1..310
AlyPrx44-2 563 0 1..310 1..310
CrubPrx117 559 0 1..310 1..310
TsPrx44 557 0 1..310 1..310
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13200653..13200853 201 N° 2 13200957..13201688 732  
join(13200653..13200853,13200957..13201688)


exon

Literature and cross-references AtPrx44 (At4g26010 / PER44 / AtperoxP44 / ATP35)
Protein ref. UniProtKB:   Q93V93
DNA ref. Phytozome 11:   Chr4 (13200653..13201688)
mRNA ref. GenBank:   NM_118734
Cluster/Prediction ref. Phytozome Gene 11:   19645428 UniGene:   At.2955
Omic ref. AtProteome:   At4g26010 ATTED-II:   At4g26010 e-FP Browser:   At4g26010 ePlant:   At4g26010 Genevestigator:   At4g26010 TAIR:   At4g26010
Protein sequence: AtPrx44 (At4g26010 / PER44 / AtperoxP44 / ATP35)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   310 (290)
PWM (Da):   %s   33670.27 (31470.1)  
PI (pH):   %s   10.49 (10.49) Peptide Signal:   %s   cut: 21 range:21-310
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSITALFFLFCFLAPSALAQLRTGFYSRSCPRAESIVASVVANRFRSDKSITAAFLRMQFHDCFVRGCDASLLIDPRPGRPSEKSTGPNASVRGYEIIDEAKRQLEAACPRTVSCADIVTLATRDSVALAGGPRFSVPTGRRDGLRSNPNDVNLPGPTIPVSASIQLFAAQGMNTNDMVTLIGGGHSVGVAHCSLFQDRLSDRAMEPSLKSSLRRKCSSPNDPTTFLDQKTSFTVDNAIYGEIRRQRGILRIDQNLGLDRSTSGIVSGYASSNTLFRKRFAEALVKMGTIKVLTGRSGEIRRNCRVFNN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, intron 1), 6 cDNA and 18 ESTs (12 in roots only).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCTTCTGCT TTTGTGACAC AGGTAGATTC CCTTAAATAC AACATCAGCT CCTGAAAACG AGTTTAGCGA TATCATCTTA CTTGTTATGA TTAGTCTTCC AGCAGTGATT TTGATCTTAA  CACATCTAAC TTGTTTCTCT GAACTAGTAG TGACGTTTCT ATAATGGATT CTCTTACTAG GTATCTCAAA CGATGCAAAT ACCATTCTCC TATGCAGAGG ATATTATTGG TGTAGAAGGA  GCTAATATAG CCTATATCCG TCGAAGAAGC GGAGCTACCA TAACCATTAA AGAGAGTCCG CATCCTGATC AAATCACAGT GGAAATCAAA GGCACAACTT CTCAAGTACA AACTGCTGAG  CAACTAATTC AAGTAAGAAC ACATTCGATC TGTATATATA TATATATACT TTCTGCGACG TGGCATTGTA TAAACACTAA GATTATGCTT GCTTTGCATC CTACCCCGCC TGCTTCATCA  TAACCGTATT CTTTTGTTTA CGTGTGTGTA GGAGTTCATC ATCAATCACA AGGAACCAGT TTCGGTATCA GGGGGATATG CCAGAATCGA CTCTGGATAT GTACCTGCAT ATCCTCCTCA  GCTAAGTAAC CGTCAAGAGC CGCTCCCGAG CACCTACATG GGCACAGAGC CGGTGCAGTA CAGACCAACA GCATACTCTC AGCTGGGGGG TCCTTCTACC TACACACCGA CCCTGACTGG  GCAAACTTAT GGTTCGGAAT ATAGACCAGC TTCTGATGTT GGTGGCTACA GCAGTTATAA TCTTTGAATT GGTTGCTGTG TTTAAGTTTA TTTGCAGATT AATTTCTCTT TAGAGAAAGG  CTCATTTATA ATATAATAGA GAGGGAAAAG GAACAAGTTC TAGAGAGCCA ATGTAGTTGT TGGAATGTGT AATGTAAATC TAGGTGCCCT TTTTTTTTTT TTTTTTCATA CCTCGATATA  TGTCACACTA CGTTTCTGGT CAAATAAGAA CATGTTTTTT CTTTCTTTTT TGTATGAATT TGTTTATCAG AAGTCAGAAT GATTCAGTTT TAAGAAATTT TTAGTTAACG TTTTACAACA  ATAACCTGTA GGAGCTTTTT CTTAATTGAA TAAGTTTAAG CTTTCTATTT TGATCTGATG ATGCTAATAT GAAAGCATTC TCCGAAGAAC CAAACCACAT GAGACTTTTT GATTTCAATG  TCCATTCGTA ACTAGTAACG GAAAAGATCA GACAGAAAAA ATGTACCAAT CATTCCATAT TTGTAGTTTT ACATGATATA GTAATATTCT CTAGGTGTTT AAGTTGTATA TTTCATGATT  TTTACACATT TTAAAACCTG ATTAAGGCCT GTTTTTAACT TTTTATTTCT TCAAACCGTA AGAAACAATC CTTGCAAGAA ACAATCCTTG CTTCTTCTTC TTTTTTTCGT CAAGAAACAA  TCCTTGCTAT ATTTTCATTT TTACAGCTTC TTGTTTTTAA GAGAGCAAAT ATAATAAATA AGGACGGCTG AAAAGAGGTA TATGTATCAC AAAATTAAAC AAAAGAGAAT CCACCTATCG  ACATAGACGT GGTATCCTTT CGATATCGAC AGAATTATGT TGAACGCAGC AAGTTGGCCA TTAATCAAAT CTTTGACGCG TGGAATCATT CTATTGTCAA TGAAAACAAA TATTAAAGAA  CAGGTACTAC CTATATACCT AATAGATTCC TCTAACCCGT CAAATGTCAA TGTATCGACC GTTACAATTA TGCACGTCTT CTAATTGAAA CATTCTCTAC TTTGCCAATG TCTTATCCCC 
AAAACTACAT ATAAATATGC ATTTACGGGG GCTTAGAATT TCATCACAAA ACTTGCAAGT ATCATTCACA GGAGAGGGAA GGGAGAGCTC ATCATACGAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGACGTTGAT TCTTGCACAC ATTCTTTACA ATTATTCACG GAGAGATCCA AAGACTGAGC GGAATCCTAC GTTTTTTCTT TTCTTTGCTT TTTTTCTTAC AAATCAAATC GGAAAGTGTG  TTTGTTCCGG TATCATGTTT TATTTTTCCC TAAAAATTGA TTCGCGTGTT TCATTTTCAT GAACTATATA TTGTTCTAAT TTGATATTAA CTTCTTTTTT TGGCTCTGTG GTGTTCTAAT  TTCTTGTTTT TTTTATGTGC TTACTCCCTT CTTAACCTAT GACGTTTTGG ATAACAATGT TTAATGAATA ATGGCTCTGT TAACAGTTTC TAAAACTCAT TCGACAAGAA CTTCGCCTTT  TCAAGGTTTT TCTACCAGCA ATATATGAGG GTTTCTTTTC AGTTTCATGT ATGTGAGAAC TATAGGTTTT GATGTATGTT TTCAACTGTA TCATCTACGA AAATATTCTG AAGAAAATGC  TTTGGGTTCA CATGGAACTT ACTTGTTGGG AGACAGAGCG GTAAGTGATT TTTGCAAGCA AAGCCTGGTT TCTGGCTGTT CTATGAAGAA GATAATTTCC GTTTAAGGAT CTCATTCTCT  TTTCTCAGTT TCATTAGCTT CTGTTTCAAT GTCTCGACCT GTCGATTTGA AGTTGTATCC CTCTGCTTTT CAGCTATTGA CGTTCTACTA ATAAGCACTG CAAATAATAA AAAGGGATCT  TCAATTAGTT TTGCAATATA TAGACTTAAG AAGTTATGTG GACTCTTAGT CTTGCTGATA AAACCTGAAA CCAAACCAAT CTATGACTTT TTAGTGAAGA GGAAAAAATT CTTACATTCC  TTCTGCAGAC TCTGAAGTTT GTTACTGATA TCATTTTTCT CTGCTTGTTC CATTAGAAGG CAGTCCTTTA GATCCTGAAT CTCGAGTTCA TCTATCAAAT GATTATATCA GGAAGCCATG 
TGAATGCCGT AAAGAAAATA CAAACTTAAG TACAATTGGA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGTCAATCACAGCTTTGTTTTTCCTTTTCTGTTTCCTTGCTCCTTCTGCTTTGGCGCAGCTCCGAACTGGGTTCTACAGCCGCTCATGCCCCCGTGCCGAATCTATCGTGGCTAGT
GTTGTTGCCAACCGTTTCAGAAGTGACAAGTCCATTACTGCAGCATTTCTTCGTATGCAGTTTCATGATTGCTTTGTCAGG
GTCCGTAAGCTTCTCCTGTGTGTACATGTGTATATATAT
TAACATAAGCTAGCTAATATTTAGACAACACATTGATCAAGCAATGTTTTGAATGGTTGTGTAGGGTTGTGATGCTTCCCTCTTGATCGACCCAAGACCTGGAAGGCCATCAGAGAAAAG
CACTGGACCAAATGCAAGCGTGAGAGGCTACGAGATCATTGATGAGGCTAAGAGACAGCTCGAGGCTGCATGTCCCCGAACTGTCTCATGCGCAGACATTGTAACTCTTGCCACAAGAGA
CTCGGTCGCATTAGCTGGTGGTCCAAGGTTCTCAGTACCAACAGGAAGACGTGATGGATTAAGGTCAAACCCCAATGATGTGAACTTACCCGGACCAACAATTCCGGTTAGCGCATCTAT
CCAATTGTTTGCAGCTCAAGGTATGAATACCAACGATATGGTTACACTTATTGGTGGTGGCCACAGCGTCGGTGTTGCACATTGCAGTCTCTTCCAGGACAGGCTTTCCGACCGTGCAAT
GGAACCCTCATTGAAGTCTAGCTTGAGGAGGAAATGCAGTTCCCCTAACGACCCAACAACGTTTTTGGACCAAAAGACTTCATTTACTGTGGATAACGCAATCTATGGAGAGATCCGAAG
ACAAAGAGGAATTCTAAGAATTGATCAAAACTTGGGTCTTGATAGATCAACCAGTGGGATTGTGTCTGGTTATGCATCAAGCAATACACTCTTCAGAAAGAGATTTGCCGAAGCATTGGT
GAAAATGGGTACCATTAAGGTTCTTACCGGACGTTCTGGAGAGATCAGGAGAAACTGCAGAGTCTTCAACAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGTCAATCACAGCTTTGTTTTTCCTTTTCTGTTTCCTTGCTCCTTCTGCTTTGGCGCAGCTCCGAACTGGGTTCTACAGCCGCTCATGCCCCCGTGCCGAATCTATCGTGGCTAGT
GTTGTTGCCAACCGTTTCAGAAGTGACAAGTCCATTACTGCAGCATTTCTTCGTATGCAGTTTCATGATTGCTTTGTCAGG
GGTTGTGATGCTTCCCTCTTGATCGACCCAAGACCTGGA
AGGCCATCAGAGAAAAGCACTGGACCAAATGCAAGCGTGAGAGGCTACGAGATCATTGATGAGGCTAAGAGACAGCTCGAGGCTGCATGTCCCCGAACTGTCTCATGCGCAGACATTGTA
ACTCTTGCCACAAGAGACTCGGTCGCATTAGCTGGTGGTCCAAGGTTCTCAGTACCAACAGGAAGACGTGATGGATTAAGGTCAAACCCCAATGATGTGAACTTACCCGGACCAACAATT
CCGGTTAGCGCATCTATCCAATTGTTTGCAGCTCAAGGTATGAATACCAACGATATGGTTACACTTATTGGTGGTGGCCACAGCGTCGGTGTTGCACATTGCAGTCTCTTCCAGGACAGG
CTTTCCGACCGTGCAATGGAACCCTCATTGAAGTCTAGCTTGAGGAGGAAATGCAGTTCCCCTAACGACCCAACAACGTTTTTGGACCAAAAGACTTCATTTACTGTGGATAACGCAATC
TATGGAGAGATCCGAAGACAAAGAGGAATTCTAAGAATTGATCAAAACTTGGGTCTTGATAGATCAACCAGTGGGATTGTGTCTGGTTATGCATCAAGCAATACACTCTTCAGAAAGAGA
TTTGCCGAAGCATTGGTGAAAATGGGTACCATTAAGGTTCTTACCGGACGTTCTGGAGAGATCAGGAGAAACTGCAGAGTCTTCAACAACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCATCACAAA ACTTGCAAGT ATCATTCACA GGAGAGGGAA GGGAGAGCTC ATCATACGAA ATGAGGTCAA TCACAGCTTT GTTTTTCCTT TTCTGTTTCC TTGCTCCTTC TGCTTTGGCG  CAGCTCCGAA CTGGGTTCTA CAGCCGCTCA TGCCCCCGTG CCGAATCTAT CGTGGCTAGT GTTGTTGCCA ACCGTTTCAG AAGTGACAAG TCCATTACTG CAGCATTTCT TCGTATGCAG  TTTCATGATT GCTTTGTCAG GGGTTGTGAT GCTTCCCTCT TGATCGACCC AAGACCTGGA AGGCCATCAG AGAAAAGCAC TGGACCAAAT GCAAGCGTGA GAGGCTACGA GATCATTGAT  GAGGCTAAGA GACAGCTCGA GGCTGCATGT CCCCGAACTG TCTCATGCGC AGACATTGTA ACTCTTGCCA CAAGAGACTC GGTCGCATTA GCTGGTGGTC CAAGGTTCTC AGTACCAACA  GGAAGACGTG ATGGATTAAG GTCAAACCCC AATGATGTGA ACTTACCCGG ACCAACAATT CCGGTTAGCG CATCTATCCA ATTGTTTGCA GCTCAAGGTA TGAATACCAA CGATATGGTT  ACACTTATTG GTGGTGGCCA CAGCGTCGGT GTTGCACATT GCAGTCTCTT CCAGGACAGG CTTTCCGACC GTGCAATGGA ACCCTCATTG AAGTCTAGCT TGAGGAGGAA ATGCAGTTCC  CCTAACGACC CAACAACGTT TTTGGACCAA AAGACTTCAT TTACTGTGGA TAACGCAATC TATGGAGAGA TCCGAAGACA AAGAGGAATT CTAAGAATTG ATCAAAACTT GGGTCTTGAT  AGATCAACCA GTGGGATTGT GTCTGGTTAT GCATCAAGCA ATACACTCTT CAGAAAGAGA TTTGCCGAAG CATTGGTGAA AATGGGTACC ATTAAGGTTC TTACCGGACG TTCTGGAGAG  ATCAGGAGAA ACTGCAGAGT CTTCAACAAC TGAGGACGTT GATTCTTGCA CACATTCTTT ACAATTATTC ACGGAGAGAT CCAAAGACTG AGCGGAATCC TACGTTTTTT CTTTTCTTTG  CTTTTTTTCT TACAAATCAA ATCGGAAAGT GTGTTTGTTC CGGTATCATG TTTTATTTTT CCCTAAAAAT TGATTCGCGT GTTTCATTTT CATGAACTAT ATATTGTTCT AATTTGATAT 
TAACTTCTTT TTTTGGCTCT GTGGTGTTCT AATTTCTTGT TTTTTT 

Retrieve as FASTA